# Inferno Plume Proteins # replicate Av1 # (Supplementary Table 3) # only protein probabilition and depth added bycation and depth added by DMO # R.Morris, PI ========================= entry lat lon depth NCBI_FASTA_link protein_probability num_unique_peptide indep_spectra_tot peptide_seq consensus_annotation KEGG_category ------------------------- 116a 45.934 -130.0138 1450 gi|269469034|gb|EEZ80598.1| 1 3 218 EALSEIGVSGITATEVK Gamma sulfur oxidizers_nitrogen regulatory protein PII Environmental Information Processing;Signal Transduction;Two-component system 116a 45.934 -130.0138 1450 gi|269469034|gb|EEZ80598.1| 1 3 218 GAEYTVDFLPK Gamma sulfur oxidizers_nitrogen regulatory protein PII Environmental Information Processing;Signal Transduction;Two-component system 116a 45.934 -130.0138 1450 gi|269469034|gb|EEZ80598.1| 1 3 218 LDDVREALSEIGVSGITATEVK Gamma sulfur oxidizers_nitrogen regulatory protein PII Environmental Information Processing;Signal Transduction;Two-component system 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 HVDSAVHKFEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 LMDEYAGGVTVQYMTNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 LMDEYAGGVTVQYM[147]TNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 IMVTHLLMDDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 LM[147]DEYAGGVTVQYMTNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 NHAFISEVAAGR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 VAAEDIHQLLR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 WQIMIHGESYKPIVAEAAK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 FEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 IM[147]VTHLLMDDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 FEEWGLPLM[147]K Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 EDLAFDMAR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 LM[147]DEYAGGVTVQYM[147]TNDK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 YIDDGKANGINVSQK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 RADLPEGDIGK Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 IM[147]VTHLLM[147]DDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 IMVTHLLM[147]DDAQDNR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 85a 45.934 -130.0138 1450 gi|269468010|gb|EEZ79735.1| 1 18 95 SGAVAQGLYAINCYMGTR Gamma sulfur oxidizers_adenylylsulfate reductase AprA Metabolism;Energy Metabolism;Sulfur metabolism 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 DIIAILGMDELSEEDKQSVSR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 DVLLFIDNIYR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 MPSAVGYQPTLASEMGALQER Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 MPSAVGYQPTLASEM[147]GALQER Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 M[147]PSAVGYQPTLASEMGALQER Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 NIAIEHSGYSVFAGVGER Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 QVAELGIYPAVDPLDSTSR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 YTLAGTEVSALLGR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 DEGRDVLLFIDNIYR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 VALTGLTM[147]AEYFR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 VSLVYGQMNEPPGNR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 DIIAILGMDELSEEDK Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 DIIAILGM[147]DELSEEDK Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 TVNMMELIR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 VSLVYGQM[147]NEPPGNR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 VGLFGGAGVGK Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 QLDPLIVGEEHYNVAR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 VALTGLTMAEYFR Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 FLSQPFFVAEVFTGAPGK Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 106a 45.934 -130.0138 1450 gi|269468571|gb|EEZ80220.1| 1 20 82 YVSLKDTISGFK Gamma sulfur oxidizers_F0F1-type ATP synthase;beta subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 ADVPLAEMFGYANDLR Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 AIYWNEEDQGATYETK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 GVQEQMENGVLAGFPLVDIK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 IATDPFVGTLTFFR Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 IEPQEPGAGYEFVDEIK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 MEFPEPVIALAVEPK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 VTVYDGSYHDVDSNEMAFK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 IGEVHDGGATMDWMEQEQER Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 GLVGAMEDLPNGK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 INIIDTPGHVDFTIEVER Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 EAITTLVEHQHK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 GVVDLITMKAIYWNEEDQGATYETK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 AGDIAAAIGLK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 GVVDLITMK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 ASYSMEFSK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 114a 45.934 -130.0138 1450 gi|269468973|gb|EEZ80551.1| 1 16 70 GLVGAM[147]EDLPNGK Gamma sulfur oxidizers_translation elongation factor Genetic Information Processing;Translation;Translation factors 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 FEAEVYILSK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 LLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 MQVELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 MQVELLSPIAM[147]EDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 M[147]QVELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 M[147]QVELLSPIAM[147]EDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 KLLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46a 45.934 -130.0138 1450 gi|118602211|ref|YP_903426.1| 1 11 64 VELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 AFESFPGDADSLYPGWR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 DLDAMVYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 DLDAM[147]VYEIDEAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 NDGGYIAGTIIKPK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 LPGFFENLGHGNVINTSGGGSYGHIDSPAAGAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 NIAYMIER Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 LMGASGIHVGTMGYGK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 GYTAFVLAK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 DRNDGGYIAGTIIKPK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 DVTPLVADSM[147]K Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 QMLDIFDGPSVDITDLWNLLGR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 MKDVTPLVADSM[147]K Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 LMGASGIHVGTM[147]GYGK Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 79a 45.934 -130.0138 1450 gi|260072614|gb|ACX30513.1| 1 14 56 DSADGPVYHQEWFGMKPTTPIISGGMNALR Gamma sulfur oxidizers_ribulose 15-bisphosphate carboxylase large subunit Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 DSVEEKAAMADYNK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 DSVEEKAAM[147]ADYNK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 EALLETLEEGKEIEGIVK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 LGQEVDVVVLDVQESK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 LWQSLETAM[147]NAK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 VGALLMGTVVSINR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 VTGTVSNLTDYGAFVR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 DFSYLTGQEIEAIVIK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 EALLETLEEGK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 GQELEVVILNIDAEK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 QLTASPWDNISDR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 GQELEVVILNIDAEKER Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 VGALLM[147]GTVVSINR Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 33 45.934 -130.0138 1450 gi|269469082|gb|EEZ80635.1| 1 14 47 AFLPGSLVDVRPVK Gamma sulfur oxidizers_ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 AAVTGDTVGDPYK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 AAVTGDTVGDPYKDTAGPAINPLIK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 EMPGIMDYTQKPDYSK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 NITDPLDAVGNTTK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 VSDGGSIMGALYK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 NGMDAAFQVAFK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 VSDGGSIM[147]GALYK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 86a 45.934 -130.0138 1450 gi|269468014|gb|EEZ79739.1| 1 8 44 NGM[147]DAAFQVAFK Gamma sulfur oxidizers_inorganic pyrophosphatase Metabolism;Energy Metabolism;Oxidative phosphorylation 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 DIALSYASAIGGGR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 EFVANVGDLPAR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 GGGIPDLIAVQQDVSGTAK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 ILGEIQDGSFAK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 LIVDLMYEGGIANMR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 YSISNTAEYGDVTR Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 IYTDNIEPNLK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 LIVDLMYEGGIANM[147]R Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 YYDKDADLNIIK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 110a 45.934 -130.0138 1450 gi|269468884|gb|EEZ80476.1| 1 10 43 ADLNVIMIAPK Gamma sulfur oxidizers_ketol-acid reductoisomerase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis or Metabolism of Cofactors and Vitamins;Pantothenate and CoA biosynthesis 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 AEAAGADVVGMEDLMK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 AEAAGADVVGM[147]EDLM[147]K Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 SMQDGDLNYDVVIASPDAMGVVGR Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 SM[147]QDGDLNYDVVIASPDAMGVVGR Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 VAVFTQGDNVAK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 VGTVTPDVATAVNNAK Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 SMQDGDLNYDVVIASPDAM[147]GVVGR Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 SM[147]QDGDLNYDVVIASPDAM[147]GVVGR Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 120a 45.934 -130.0138 1450 gi|269469121|gb|EEZ80669.1| 1 9 37 AEAAGADVVGMEDLM[147]K Gamma sulfur oxidizers_ribosomal protein L1 Genetic Information Processing;Translation;Ribosome 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 INAEDPNNFMPSPGK Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 ITQYHVAGGLGVR Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 MQNALDEMVIDGIK Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 VEESGFIFIGPR Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 VQVEHPVTEMITGIDIVR Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 VVEEAPAPGITPELR Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 M[147]QNALDEMVIDGIK Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 INAEDPNNFM[147]PSPGK Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 104a 45.934 -130.0138 1450 gi|269468557|gb|EEZ80206.1| 1 9 33 MQNALDEM[147]VIDGIK Gamma sulfur oxidizers_biotin carboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or propanoate metabolism or Lipid Metabolism;Fatty acid biosynthesis or Metabolism of Terpenoids and Polyketides;Tetracycline biosynthesis 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 FVNILMLDGK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 LAGEVLDAVQNR Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 IVYDALDTIEAK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 VGGSTYQVPIEVR Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 FGDLVLAK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 FVNILMLDGKK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 113a 45.934 -130.0138 1450 gi|269468972|gb|EEZ80550.1| 1 7 32 FVNILM[147]LDGK Gamma sulfur oxidizers_ribosomal protein S7 Genetic Information Processing;Translation;Ribosome 162 45.934 -130.0138 1450 gi|344263298|gb|EGW23569.1| 0.9996 2 31 FAGLLFFFDEAGNR Methylotrophs_methane monooxygenase/ammonia monooxygenase;subunit B Metabolism;Energy Metabolism;methane metabolism or nitrogen metabolism 162 45.934 -130.0138 1450 gi|344263298|gb|EGW23569.1| 0.9996 2 31 LADLIYDPDSR Methylotrophs_methane monooxygenase/ammonia monooxygenase;subunit B Metabolism;Energy Metabolism;methane metabolism or nitrogen metabolism 32 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 29 DDAWGGSDFTFGDVTLR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 32 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 29 FAEPARDDAWGGSDFTFGDVTLR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 32 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 29 GSNPLTLTLER Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 32 45.934 -130.0138 1450 gi|269469056|gb|EEZ80614.1| 1 4 29 SQSYEIFIPSIR Gamma sulfur oxidizers_hypothetical protein Sup05_0291 Unassigned 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 MLSDGEDLPEEFSRPEVAK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 TTEDAHPGVVMVKAQGK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 VLQAYYATIK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 DHAGVDDYYGPFDAHNIFDEIADDALVTQPLK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 LVPPHGSDTINALALSGDALSAELSR Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 EALLHALFR Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 M[147]LSDGEDLPEEFSRPEVAK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 126a 45.934 -130.0138 1450 gi|269469203|gb|EEZ80739.1| 1 8 29 SGDIIATM[147]SVTEK Gamma sulfur oxidizers_ATP sulfurylase Metabolism;Energy Metabolism;Sulfur metabolism or Nucleotide Metabolism;Purine metabolism 31 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 1 5 28 DSANGDTSVLVVDAR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 31 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 1 5 28 TIYNFCNGAWCGQSPASIR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 31 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 1 5 28 GVMEVAGISR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 31 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 1 5 28 TSRPCPPFCINATNPFAPAKVETVTELDVIHAAR Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 31 45.934 -130.0138 1450 gi|269468810|gb|EEZ80414.1| 1 5 28 NQDNKATIDPAFAK Gamma sulfur oxidizers_hypothetical protein Sup05_0850 Unassigned (possible SoxL gene) 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 HVDSAVHKFEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 VAGAVGFNVR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 VWYAPWSSGSAYGLLIEAGAK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 FEEWGLPLMK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 TSECVTQHTLFR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 TTIVGAGGASNIFKPR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 FEEWGLPLM[147]K Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 TYTQNGYGDEYESK Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 85b 45.934 -130.0138 1450 gi|148244258|ref|YP_001218952.1| 1 9 27 SGAVAQGLYAINCYMGTR Gamma sulfur oxidizers_adenylylsulfate reductase subunit alpha Metabolism;Energy Metabolism;Sulfur metabolism 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 IFLQQSDTVLTALDAK Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 LGM[147]TNTQAPLVVK Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 GFLAAYNIR Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 WSMSLWAR Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 DSSLSTWEGDQWK Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 39 45.934 -130.0138 1450 gi|357406818|ref|YP_004918742.1| 1 6 26 VITGISGGEFGVR Methylotrophs_xoxF gene product Metabolism;Energy Metabolism; 211 45.934 -130.0138 1450 gi|118602789|ref|YP_904004.1| 0.995 1 26 QLEEAGASVELK Gamma sulfur oxidizers_50S ribosomal protein L7/L12 Genetic Information Processing;Translation;Ribosome 211 45.934 -130.0138 1450 gi|269469119|gb|EEZ80667.1| 0.995 1 26 QLEEAGASVELK Gamma sulfur oxidizers_50S ribosomal protein L7/L12 Genetic Information Processing;Translation;Ribosome 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 GIILSGGPDTVTTDDSAR Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 LPYDFLDFVSNR Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 AVETIDFMTAR Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 LNEGDEVMQTFADNMGVK Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 VVYDISGKPPATIEWE Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 FYDALADEADPEK Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 100a 45.934 -130.0138 1450 gi|269468374|gb|EEZ80039.1| 1 7 25 NWTTDNIITDLIENLK Gamma sulfur oxidizers_GMP synthase;PP-ATPase domain/subunit Metabolism;Nucleotide Metabolism;Purine metabolism 66a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 5 25 DHGFMPIVVDVVSK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 66a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 5 25 FLITSNDVIHNWWVPDFGVK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 66a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 5 25 QDANPGFINDAWAKIDEIGTYR Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 66a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 5 25 DHGFM[147]PIVVDVVSK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 66a 45.934 -130.0138 1450 gi|148244203|ref|YP_001218897.1| 1 5 25 QDANPGFINDAWAK Gamma sulfur oxidizers_cytochrome c oxidase subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 GNFMGTWDQVLVNSLR Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 IAVIGQAFPR Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 LMWDVAADYLR Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 MGGMDYTIDPAAGLGER Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 VSGWAQVGSIGNGR Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 YDGNGLFDEDEALPFKPYVIK Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 YIGVMDLNIVDHK Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 TYDAILTEK Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 69b 45.934 -130.0138 1450 gi|269468986|gb|EEZ80559.1| 1 9 24 GNFM[147]GTWDQVLVNSLR Gamma sulfur oxidizers_sulfate thiol esterase SoxB Unassigned 35 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 23 DMEFFHQAMSNGIEISADR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 35 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 23 DQFEEILDGIPPYEEAVEK Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 35 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 23 LAHPYYDDAAGTVVTLEGTIR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 35 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 23 ISSWISDQAAGEK Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 35 45.934 -130.0138 1450 gi|269469112|gb|EEZ80660.1| 1 5 23 WGGIGTLHR Gamma sulfur oxidizers_sulfur oxidation protein SoxA Unassigned 118a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 4 23 IAENGAVVPMTVDASK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 118a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 4 23 IAENGAVVPM[147]TVDASK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 118a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 4 23 TSPVDALVTAGGATTK Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 118a 45.934 -130.0138 1450 gi|269469114|gb|EEZ80662.1| 1 4 23 NNGTPLAASFNLSGAQGYVSTR Gamma sulfur oxidizers_sulfur oxidation protein SoxY Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 EIDDVPIINLTLWSK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 ITIGTAIDAVR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 LIPDNVEVSVTR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 ATGEQAVTIAIAK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 EIFHIDAYPGR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 NSILLVDFTVQEYAK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 57a 45.934 -130.0138 1450 gi|118602552|ref|YP_903767.1| 1 7 23 DLADVEYVLGEPK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 21 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 22 DANVVAPFDGVIVVK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 21 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 22 LKDANVVAPFDGVIVVK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 21 45.934 -130.0138 1450 gi|269468229|gb|EEZ79919.1| 1 3 22 SSLPSVFVINPK Gamma sulfur oxidizers_hypothetical protein Sup05_1072 Unassigned 29 45.934 -130.0138 1450 gi|269468568|gb|EEZ80217.1| 1 2 22 DQAAEIIANAGR Gamma sulfur oxidizers_F0F1-type ATP synthase;subunit b Metabolism;Energy Metabolism;Oxidative phosphorylation 29 45.934 -130.0138 1450 gi|269468568|gb|EEZ80217.1| 1 2 22 FIWPPIVAAMDER Gamma sulfur oxidizers_F0F1-type ATP synthase;subunit b Metabolism;Energy Metabolism;Oxidative phosphorylation 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 AGELGVDIYNLTK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 LDEVGVVYVGAR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 LGPEEITADIPNVSESALAK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 QISSVAASLIPFLEHDDANR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 SINAPLEYLLDK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 STGPYSLVTQQPLSGK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 EFFGSSQLSQFMDQVNPLSGVTHK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 FGEMEVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 FGEM[147]EVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 SETGEHVLTNDDIISVLK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 EGLNLAETDELTPQDLINSKPVSAAVR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 ISALGPGGLTR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 IAFMPWNGYNFEDSILISER Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 LNLVLFDK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 SLGIDVELEQH Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 119a 45.934 -130.0138 1450 gi|269469118|gb|EEZ80666.1| 1 16 22 YTTIHIEELTAYSR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta subunit Genetic Information Processing;Transcription;RNA polymerase 77a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 22 AGSLSAPIEIIEER Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 77a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 22 IVVQLPGVQDTAR Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 77a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 22 VNELGVAEPIIQQQGLER Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 77a 45.934 -130.0138 1450 gi|148245036|ref|YP_001219730.1| 1 4 22 EILGAVATLEFR Gamma sulfur oxidizers_preprotein translocase SecD subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 128a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 21 ATVEGLTSMTSPQSVAAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 128a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 21 ATVEGLTSM[147]TSPQSVAAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 128a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 21 IFGFSALVVVGDGNGK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 128a 45.934 -130.0138 1450 gi|269469219|gb|EEZ80750.1| 1 4 21 SVLEAVGVHNILAK Gamma sulfur oxidizers_ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 56a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 21 INDVQAYLFNVANPDTTLR Gamma sulfur oxidizers_HflK protein Unassigned 56a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 21 LINEAQTYANDILPK Gamma sulfur oxidizers_HflK protein Unassigned 56a 45.934 -130.0138 1450 gi|118602544|ref|YP_903759.1| 1 3 21 ANSMMYLPIDK Gamma sulfur oxidizers_HflK protein Unassigned 136 45.934 -130.0138 1450 gi|269468075|gb|EEZ79789.1| 0.9999 2 20 TTEVDGYSAVQVTTGAK Gamma sulfur oxidizers_ribosomal protein L3 Genetic Information Processing;Translation;Ribosome 136 45.934 -130.0138 1450 gi|269468075|gb|EEZ79789.1| 0.9999 2 20 IMSEDGSATAVSVIK Gamma sulfur oxidizers_ribosomal protein L3 Genetic Information Processing;Translation;Ribosome 58a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 5 20 NLMLDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 5 20 AAVEEGVVPGGGVALVR Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 5 20 NLMLDGVNM[147]LANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 5 20 SVAAGMNPMDLK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|118602570|ref|YP_903785.1| 1 5 20 NLM[147]LDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 5 20 AAVEEGVVPGGGVALVR Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 5 20 NLMLDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 5 20 NLMLDGVNM[147]LANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 5 20 SVAAGMNPMDLK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 58a 45.934 -130.0138 1450 gi|148244665|ref|YP_001219359.1| 1 5 20 NLM[147]LDGVNMLANAVK Gamma sulfur oxidizers_chaperonin GroEL Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 74a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 20 GIGSAFTVR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing;Translation;Ribosome 74a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 20 MNLIDQIENEQLR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing;Translation;Ribosome 74a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 20 M[147]NLIDQIENEQLR Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing;Translation;Ribosome 74a 45.934 -130.0138 1450 gi|148244933|ref|YP_001219627.1| 1 4 20 LQAFEGVVIAK Gamma sulfur oxidizers_50S ribosomal protein L19 Genetic Information Processing;Translation;Ribosome 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 DQGVDLTNDPMALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 QAVTNPENTLYAIK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 DQGVDLTNDPM[147]ALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 HFEVLSTNGDTFLGGEDFDQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 NMADSLIHSTK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51a 45.934 -130.0138 1450 gi|118602385|ref|YP_903600.1| 0.9996 6 19 IINEPTAAALAYGVDK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 EFGFTVDNVVATAK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 GNAPTGLVFSR Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 ANSGHPGAPMGMADIAEVLWNDHMK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 VVSMPCTNAYDEQDQAYK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 YVGIDGGLVCMTTFGESAPAGDLFK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 VNADNANGNYISWGVR Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 95a 45.934 -130.0138 1450 gi|269468179|gb|EEZ79878.1| 1 7 19 IAIEAGVGDGWYK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 ALVIGYGDVGK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 VPAINVNDSVTK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 DIHGISEETTTGVHR Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 IM[147]DGSFANQVLAQMHLFDAK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 IMDGSFANQVLAQMHLFDAK Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 103a 45.934 -130.0138 1450 gi|269468540|gb|EEZ80194.1| 1 6 18 VADM[147]SLADYGR Gamma sulfur oxidizers_S-adenosylhomocysteine hydrolase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 22 45.934 -130.0138 1450 gi|269468231|gb|EEZ79921.1| 1 3 17 DLADVEYVLGEPIGR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 22 45.934 -130.0138 1450 gi|269468231|gb|EEZ79921.1| 1 3 17 LSAPIYAM[147]M[147]GVDDLLLR Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 22 45.934 -130.0138 1450 gi|269468231|gb|EEZ79921.1| 1 3 17 NSILLVDFTVQEYAK Gamma sulfur oxidizers_acriflavin resistance protein Unassigned 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 AMMDEIGFEDFIDADGK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 FATSDLNDLYR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 GLMAKPDGSIIETPITSNFR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 LASFNSVYMMADSGAR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 LLELDAPEIIVR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 NTDPLTGLTFFEMIDEAER Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 QLLTEEMYFDALDEYGDDEFEAK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 M[147]ALELFKPFIYNR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 NTDPLTGLTFFEM[147]IDEAER Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 LGLLMDMTLK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 VADLFEAR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61a 45.934 -130.0138 1450 gi|118602787|ref|YP_904002.1| 1 12 17 TSDITGGLPR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 83a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 5 17 AAIGTTGNGIGPAYEDK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 83a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 5 17 NVVIIGTQWGDEGK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 83a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 5 17 VGGGPFPTELIYDVSTDEGDEIGK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 83a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 5 17 LDVLDSLDSIK Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 83a 45.934 -130.0138 1450 gi|269467824|gb|EEZ79573.1| 1 5 17 TVLHLIPSGILR Gamma sulfur oxidizers_adenylosuccinate synthase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 IIQELEGMFR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 MEEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 QLGIYSASGQLYQPEDSDK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 VGDLAWAAGDMQAK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 YPELLAMVEHMSDDEIYHLNR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 M[147]EEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54a 45.934 -130.0138 1450 gi|118602472|ref|YP_903687.1| 0.9999 7 16 TFGMEGLFR Gamma sulfur oxidizers_pyruvate dehydrogenase subunit E1 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 EILEGIADNLFVQDPYLQSGGDMVR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 GNFMGTWDQVLVNSLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 IAVIGQAFPR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 LMWDVAADYLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 EILEGIADNLFVQDPYLQSGGDM[147]VR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 TYDAILTEK Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 69a 45.934 -130.0138 1450 gi|148244322|ref|YP_001219016.1| 1 7 16 GNFM[147]GTWDQVLVNSLR Gamma sulfur oxidizers_sulfur oxidation protein SoxB Unassigned 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 ADMVDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 ADM[147]VDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244327|ref|YP_001219021.1| 0.9317 8 15 VELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 ADMVDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 ADM[147]VDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46b 45.934 -130.0138 1450 gi|148244885|ref|YP_001219579.1| 0.9317 8 15 VELLSPIAMEDGLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 FEAEVYILSK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 LLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 ADMVDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 KLLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468073|gb|EEZ79787.1| 0.9317 10 15 ADM[147]VDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 FEAEVYILSK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 LLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 ADMVDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 KLLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1| 0.9317 10 15 ADM[147]VDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269468974|gb|EEZ80552.1|| 0.9317 10 15 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 ADM[147]VDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 FEAEVYILSK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 LLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 QVGVPYIVVYMNK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 ADMVDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 ADMVDDEELVELVEMEIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 QVGVPYIVVYM[147]NK Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 NMITGAAQMDGAIIVIAATDGPMAQTR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 KLLDSGEAGDNVGVLLR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 46c 45.934 -130.0138 1450 gi|269469125|gb|EEZ80673.1| 0.9317 10 15 ADM[147]VDDEELVELVEM[147]EIR Gamma sulfur oxidizers_elongation factor Tu Unassigned (translation factors) 82a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 4 15 IPTAPTPLTQTGVVMR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 82a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 4 15 EVVLFESLFK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 82a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 4 15 IPTAPTPLTQTGVVM[147]R Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 82a 45.934 -130.0138 1450 gi|269467777|gb|EEZ79538.1| 1 4 15 HISPWALK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrM Unassigned 88a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 4 15 HLASESDVEQAYALGEAAVNMALEGK Gamma sulfur oxidizers_6-phosphofructokinase Metabolism;Carbohydrate Metabolism; 88a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 4 15 TSNNPYTWEIGSGELK Gamma sulfur oxidizers_6-phosphofructokinase Metabolism;Carbohydrate Metabolism; 88a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 4 15 IFVLEVMGR Gamma sulfur oxidizers_6-phosphofructokinase Metabolism;Carbohydrate Metabolism; 88a 45.934 -130.0138 1450 gi|269468017|gb|EEZ79742.1| 1 4 15 NSVMPAIIR Gamma sulfur oxidizers_6-phosphofructokinase Metabolism;Carbohydrate Metabolism; 18 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 4 14 FEAFGSAGNADK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 18 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 4 14 HLIENTSNFDPR Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 18 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 4 14 HLIENTSNFDPRK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 18 45.934 -130.0138 1450 gi|269468173|gb|EEZ79872.1| 1 4 14 FEAFGSAGNADKIK Gamma sulfur oxidizers_fructose/tagatose bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 106b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 5 14 FLSQPFFVAEVFTGSPGK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 5 14 QIAEIGIYPAVDPLDSTSR SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 5 14 FTQAGSEVSALLGR SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 5 14 DIIAILGMDELSEEDK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|71082935|ref|YP_265654.1| 1 5 14 DIIAILGM[147]DELSEEDK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 5 14 FLSQPFFVAEVFTGSPGK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 5 14 QIAEIGIYPAVDPLDSTSR SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 5 14 FTQAGSEVSALLGR SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 5 14 DIIAILGMDELSEEDK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 106b 45.934 -130.0138 1450 gi|91718443|gb|EAS85093.1| 1 5 14 DIIAILGM[147]DELSEEDK SAR11_atpD gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 EGYEVASEVTNPDAILVR Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 IALLPEGATILNFAR Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 GVVVFNAPGANANAVK Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 VIGFDPSITIK Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 AGAGVNNIPLDK Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 YYVTDFPIDDKK Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 107a 45.934 -130.0138 1450 gi|269468603|gb|EEZ80247.1| 1 7 14 ELVISSMLLSSR Gamma sulfur oxidizers_phosphoglycerate dehydrogenase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 SIAWGIAESMAK Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 LLDYAADSSALKR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 ALIVGVASNR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 LLDYAADSSALK Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 EALDGNYVEATTR Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 112a 45.934 -130.0138 1450 gi|269468956|gb|EEZ80537.1| 1 6 14 ENFATAHDISSYSFTALAK Gamma sulfur oxidizers_Enoyl-acyl-carrier-protein Metabolism;Lipid Metabolism;Fatty acid biosynthesis 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 IEYYSIIYNLIDDVK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 GSAQALVEALEELSTDEVR Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 KGDIMIAGLEYGK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 AIMSGLLSPALSENIIGIANVK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 MEEGDVSTVNVLLK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 115a 45.934 -130.0138 1450 gi|269468998|gb|EEZ80566.1| 1 6 14 VTTILVQSGTLK Gamma sulfur oxidizers_translation initiation factor 2 Unassigned 121a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 14 VPVVITVYNDR Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing;Translation;Ribosome 121a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 14 TPPAALLILK Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing;Translation;Ribosome 121a 45.934 -130.0138 1450 gi|269469122|gb|EEZ80670.1| 1 3 14 AQLEEVAAIK Gamma sulfur oxidizers_ribosomal protein L11 Genetic Information Processing;Translation;Ribosome 123a 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 4 14 ELAAQVQDSVATYGK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 123a 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 4 14 TAGFTLPILQLLSK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 123a 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 4 14 FDQLEIIVFDEADR Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 123a 45.934 -130.0138 1450 gi|269469155|gb|EEZ80700.1| 1 4 14 VNVLVATDIAAR Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 193a 45.934 -130.0138 1450 gi|118602119|ref|YP_903334.1| 0.9965 3 14 AEFPADAAEFER Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 193a 45.934 -130.0138 1450 gi|118602119|ref|YP_903334.1| 0.9965 3 14 IAIEAGVGDGWYK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 193a 45.934 -130.0138 1450 gi|118602119|ref|YP_903334.1| 0.9965 3 14 GCDAVESAVSWK Gamma sulfur oxidizers_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 DRGEDALIVYDDLTK Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 EAYPGDVFYLHSR Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 GEDALIVYDDLTK Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 TEGTVVSVTDGIVR Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 ELAAFAQFASDLDESTR Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 65b 45.934 -130.0138 1450 gi|291615438|ref|YP_003525595.1| 0.9949 6 14 TAVAVDAIINQK Iron oxidizers_ATP synthase F1;subunit alpha Metabolism;Energy Metabolism;Oxidative phosphorylation 72a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 IDLSQEVSNSVYR Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 72a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 TIILANAYR Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 72a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 TIADVVSGER Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 72a 45.934 -130.0138 1450 gi|148244638|ref|YP_001219332.1| 1 4 14 KNVIVDSYVK Gamma sulfur oxidizers_membrane protease subunit HflC Unassigned 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 GRPTEGEASDEFTLQPVADR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 KLPAVEILEQR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 LTELLGVNVR Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 IVDQLVVGGGIANTFIAAQGHNVGK Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 ISYISTGGGAFLEFLEGK Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 94a 45.934 -130.0138 1450 gi|269468176|gb|EEZ79875.1| 1 6 14 LTVLESLSK Gamma sulfur oxidizers_3-phosphoglycerate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 EVVTGIVTGAVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 SIDDGLGNTLLSHADAK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 DFSYLTGQEIEAIVIK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 GQELEVVILNIDAEK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 GQELEVVILNIDAEKER Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 7 45.934 -130.0138 1450 gi|148244694|ref|YP_001219388.1| 1 6 13 AFLPGSLVDVRPVK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 175 45.934 -130.0138 1450 gi|357406677|ref|YP_004918601.1| 0.9991 2 13 ALEGDTSDIGVPSILK Methylotrophs_tufB gene product Unassigned 175 45.934 -130.0138 1450 gi|357406677|ref|YP_004918601.1| 0.9991 2 13 LLDQGQAGDNVGVLLR Methylotrophs_tufB gene product Unassigned 175 45.934 -130.0138 1450 gi|357406689|ref|YP_004918613.1| 0.9991 2 13 ALEGDTSDIGVPSILK Methylotrophs_tufB gene product Unassigned 175 45.934 -130.0138 1450 gi|357406689|ref|YP_004918613.1| 0.9991 2 13 LLDQGQAGDNVGVLLR Methylotrophs_tufB gene product Unassigned 48a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 13 ADVDYSSYGANTQYGVIGIK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 48a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 13 LVAENIAQQLEK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 48a 45.934 -130.0138 1450 gi|118602219|ref|YP_903434.1| 1 3 13 WYANSQDYSK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 48a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 13 ADVDYSSYGANTQYGVIGIK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 48a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 13 LVAENIAQQLEK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 48a 45.934 -130.0138 1450 gi|269468081|gb|EEZ79795.1| 1 3 13 WYANSQDYSK Gamma sulfur oxidizers_30S ribosomal protein S3 Genetic Information Processing;Translation;Ribosome 67a 45.934 -130.0138 1450 gi|148244239|ref|YP_001218933.1| 1 2 13 ADYVALSFPVSGDDVR Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 67a 45.934 -130.0138 1450 gi|148244239|ref|YP_001218933.1| 1 2 13 GDLGVEIGDAQLPAQQK Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 34 45.934 -130.0138 1450 gi|269469106|gb|EEZ80654.1| 1 3 12 AEIEGEMGASHMGLQAR Gamma sulfur oxidizers_RecA/RadA recombinase Genetic Information Processing;Replication and Repair;Homologous recombination 34 45.934 -130.0138 1450 gi|269469106|gb|EEZ80654.1| 1 3 12 AGAWYSVEGER Gamma sulfur oxidizers_RecA/RadA recombinase Genetic Information Processing;Replication and Repair;Homologous recombination 34 45.934 -130.0138 1450 gi|269469106|gb|EEZ80654.1| 1 3 12 VVEIYGPESSGK Gamma sulfur oxidizers_RecA/RadA recombinase Genetic Information Processing;Replication and Repair;Homologous recombination 105a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 4 12 ITSAMEMVAASK Gamma sulfur oxidizers_F0F1-type ATP synthase;gamma subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 105a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 4 12 SATDNAGDMVKDLELVYNK Gamma sulfur oxidizers_F0F1-type ATP synthase;gamma subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 105a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 4 12 SATDNAGDM[147]VKDLELVYNK Gamma sulfur oxidizers_F0F1-type ATP synthase;gamma subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 105a 45.934 -130.0138 1450 gi|269468570|gb|EEZ80219.1| 1 4 12 IGIIIISSDR Gamma sulfur oxidizers_F0F1-type ATP synthase;gamma subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 52a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 5 12 VEQSLEAAFVDYGK Gamma sulfur oxidizers_ribonuclease Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 52a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 5 12 IQIGTISQFGLLEMSR Gamma sulfur oxidizers_ribonuclease Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 52a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 5 12 EFVSFVLPHYLDR Gamma sulfur oxidizers_ribonuclease Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 52a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 5 12 ITLLPNPYMQFPNFTINK Gamma sulfur oxidizers_ribonuclease Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 52a 45.934 -130.0138 1450 gi|118602451|ref|YP_903666.1| 1 5 12 FGLLEMSR Gamma sulfur oxidizers_ribonuclease Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 78a 45.934 -130.0138 1450 gi|260072550|gb|ACX30450.1| 1 2 12 DSPILILDEATSALDSATEK Gamma sulfur oxidizers_ABC-type multidrug transporter ATPase and permease component Environmental Information Processing;Membrane Transport;ABC transporters 78a 45.934 -130.0138 1450 gi|260072550|gb|ACX30450.1| 1 2 12 SQIAFVDQNVR Gamma sulfur oxidizers_ABC-type multidrug transporter ATPase and permease component Environmental Information Processing;Membrane Transport;ABC transporters 4 45.934 -130.0138 1450 gi|118602232|ref|YP_903447.1| 1 2 11 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|118602232|ref|YP_903447.1| 1 2 11 VGFEGGQM[147]PLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|291613255|ref|YP_003523412.1| 1 2 11 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|291613255|ref|YP_003523412.1| 1 2 11 VGFEGGQM[147]PLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|302877820|ref|YP_003846384.1| 1 2 11 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|302877820|ref|YP_003846384.1| 1 2 11 VGFEGGQM[147]PLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|344262228|gb|EGW22499.1| 1 2 11 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|344262228|gb|EGW22499.1| 1 2 11 VGFEGGQM[147]PLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|357406656|ref|YP_004918580.1| 1 2 11 VGFEGGQMPLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 4 45.934 -130.0138 1450 gi|357406656|ref|YP_004918580.1| 1 2 11 VGFEGGQM[147]PLQR Bacteria_50S ribosomal protein L15P Genetic Information Processing;Translation;Ribosome 9 45.934 -130.0138 1450 gi|148244929|ref|YP_001219623.1| 1 2 11 ISGLGQLIEAGIQSDR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 9 45.934 -130.0138 1450 gi|148244929|ref|YP_001219623.1| 1 2 11 VFFYHDGVNNASR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 9 45.934 -130.0138 1450 gi|269467773|gb|EEZ79534.1| 1 2 11 ISGLGQLIEAGIQSDR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 9 45.934 -130.0138 1450 gi|269467773|gb|EEZ79534.1| 1 2 11 VFFYHDGVNNASR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrE Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 28 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 4 11 IEQAFELTDASAER Gamma sulfur oxidizers_aconitase B Metabolism;Carbohydrate Metabolism 28 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 4 11 ILEIEGLGDLK Gamma sulfur oxidizers_aconitase B Metabolism;Carbohydrate Metabolism 28 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 4 11 DLVNAIPYVAIQQGLLTVEK Gamma sulfur oxidizers_aconitase B Metabolism;Carbohydrate Metabolism 28 45.934 -130.0138 1450 gi|269468484|gb|EEZ80145.1| 1 4 11 GGVALKPGDGIIHSWLNR Gamma sulfur oxidizers_aconitase B Metabolism;Carbohydrate Metabolism 219 45.934 -130.0138 1450 gi|148244649|ref|YP_001219343.1| 0.995 1 11 NINKGDVVQPGQILIK Gamma sulfur oxidizers_multidrug efflux system Unassigned 101a 45.934 -130.0138 1450 gi|269468482|gb|EEZ80143.1| 1 3 11 IGYFNPVAR Gamma sulfur oxidizers_ribosomal protein S16 Genetic Information Processing;Translation;Ribosome 101a 45.934 -130.0138 1450 gi|269468482|gb|EEZ80143.1| 1 3 11 KKPFYSIVATDSR Gamma sulfur oxidizers_ribosomal protein S16 Genetic Information Processing;Translation;Ribosome 101a 45.934 -130.0138 1450 gi|269468482|gb|EEZ80143.1| 1 3 11 LTIEEDRLDYWTSK Gamma sulfur oxidizers_ribosomal protein S16 Genetic Information Processing;Translation;Ribosome 117a 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 5 11 DLEFLAEENFTQFGK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 117a 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 5 11 LKDLEFLAEENFTQFGK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 117a 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 5 11 NGVHIINLEK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 117a 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 5 11 WLGGMMTNYK Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 117a 45.934 -130.0138 1450 gi|269469077|gb|EEZ80632.1| 1 5 11 MLEAGVHFGHR Gamma sulfur oxidizers_ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 DIDDEFGIIDGDIFR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 LDEVGVVYVGAR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 QIASVAASLIPFLEHDDANR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 STGPYSLVTQQPLSGK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 EFFGSSQLSQFMDQVNPLSGVTHK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 FGEMEVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 FGEM[147]EVWALEAYGAAHTLR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 EGLNLAETDELTPQDLINSKPVSAAVR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 ISALGPGGLTR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 DGNDSVDDVDTLANR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 SLGIDVELEQH Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 119b 45.934 -130.0138 1450 gi|118602788|ref|YP_904003.1| 1 12 11 YTTIHIEELTAYSR Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 125a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 0.9994 5 11 LVNIGIVSANR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism;Energy Metabolism;Oxidative phosphorylation 125a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 0.9994 5 11 QGSLLDFIADFVK Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism;Energy Metabolism;Oxidative phosphorylation 125a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 0.9994 5 11 MPQYLESDFR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism;Energy Metabolism;Oxidative phosphorylation 125a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 0.9994 5 11 QYDDLLTDNR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism;Energy Metabolism;Oxidative phosphorylation 125a 45.934 -130.0138 1450 gi|269469171|gb|EEZ80713.1| 0.9994 5 11 APGFAHLAAMDEMAR Gamma sulfur oxidizers_NADH dehydrogenase I chain D Metabolism;Energy Metabolism;Oxidative phosphorylation 156a 45.934 -130.0138 1450 gi|269467771|gb|EEZ79532.1| 0.9996 3 11 TLVNAFLDDM[147]HRPALPYK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrA Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 156a 45.934 -130.0138 1450 gi|269467771|gb|EEZ79532.1| 0.9996 3 11 TLVNAFLDDMHRPALPYK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrA Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 156a 45.934 -130.0138 1450 gi|269467771|gb|EEZ79532.1| 0.9996 3 11 IGDLFGTVVVPFMK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrA Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 176a 45.934 -130.0138 1450 gi|148244204|ref|YP_001218898.1| 0.999 2 11 VFNWISTMWR Gamma sulfur oxidizers_cytochrome c oxidase subunit I Metabolism;Energy Metabolism;Oxidative phosphorylation 176a 45.934 -130.0138 1450 gi|148244204|ref|YP_001218898.1| 0.999 2 11 GLEWTLEPK Gamma sulfur oxidizers_cytochrome c oxidase subunit I Metabolism;Energy Metabolism;Oxidative phosphorylation 44a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 11 FEAFGSAGNADK Gamma sulfur oxidizers_fructose-bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 44a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 11 LDLDMLLTSVEEAADFVK Gamma sulfur oxidizers_fructose-bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 44a 45.934 -130.0138 1450 gi|118602123|ref|YP_903338.1| 1 3 11 LDLDM[147]LLTSVEEAADFVK Gamma sulfur oxidizers_fructose-bisphosphate aldolase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 SALEIVETAK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 SALEIVETAKR Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 FTVLTSPHVNKK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 GPIPLPTK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 FTVLTSPHVNK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 47a 45.934 -130.0138 1450 gi|118602212|ref|YP_903427.1| 1 6 11 LMDVISPTDK Gamma sulfur oxidizers_SSU ribosomal protein S10P Genetic Information Processing;Translation;Ribosome 73a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 1 4 11 NHEEIWTVR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 73a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 1 4 11 IGWPAFFEK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 73a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 1 4 11 IALWIGGK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 73a 45.934 -130.0138 1450 gi|148244930|ref|YP_001219624.1| 1 4 11 MPIESGCPDPIQYMHPTMR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrB Metabolism;Xenobiotics Biodegradation and Metabolism;Nitrotoluene degradation 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 VGLDPIVDLNADDAR Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 FLGVDPILGPEMR Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 TPASFEPSIDYVVTK Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 GLETDKVGLDPIVDLNADDAR Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 IFYLADAFR Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 75a 45.934 -130.0138 1450 gi|148244935|ref|YP_001219629.1| 1 6 11 LTIIEMNPR Gamma sulfur oxidizers_carbamoyl-phosphate synthase large subunit Metabolism;Nucleotide Metabolism;Pyrimidine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 84a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 5 11 FNLSTGDLVAGK Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 84a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 5 11 GEVIASTFDESAKR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 84a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 5 11 GEVIASTFDESAK Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 84a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 5 11 IFPAININASGTR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 84a 45.934 -130.0138 1450 gi|269467940|gb|EEZ79675.1| 1 5 11 ILHPMDTVEAAEFLIDR Gamma sulfur oxidizers_transcription termination factor Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 3 45.934 -130.0138 1450 gi|118602070|ref|YP_903285.1| 1 1 10 VWNEHLAEYYTPR Gamma sulfur oxidizers_cytochrome b/b6 domain-containing protein Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 3 45.934 -130.0138 1450 gi|148244180|ref|YP_001218874.1| 1 1 10 VWNEHLAEYYTPR Gamma sulfur oxidizers_cytochrome b/b6 domain-containing protein Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 6 45.934 -130.0138 1450 gi|118602578|ref|YP_903793.1| 1 3 10 GPMVTQALEQMLR Gamma sulfur oxidizers_hypothetical protein Rmag_0571 Unassigned 6 45.934 -130.0138 1450 gi|118602578|ref|YP_903793.1| 1 3 10 IPVSGSVIVTTPQDIALIDAK Gamma sulfur oxidizers_hypothetical protein Rmag_0571 Unassigned 6 45.934 -130.0138 1450 gi|118602578|ref|YP_903793.1| 1 3 10 GPM[147]VTQALEQMLR Gamma sulfur oxidizers_hypothetical protein Rmag_0571 Unassigned 12 45.934 -130.0138 1450 gi|269467791|gb|EEZ79549.1| 1 2 10 MDALEPMLINMEEMNK Gamma sulfur oxidizers_hypothetical protein Sup05_0786 Unassigned 12 45.934 -130.0138 1450 gi|269467791|gb|EEZ79549.1| 1 2 10 LANSMDPNMGGNMSAMVSSIEK Gamma sulfur oxidizers_hypothetical protein Sup05_0786 Unassigned 15 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 4 10 LGQGELAGILGATEDENIQGETQK Gamma sulfur oxidizers_fructose-1_6-bisphosphatase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 15 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 4 10 MLDVISNDLLK Gamma sulfur oxidizers_fructose-1_6-bisphosphatase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 15 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 4 10 M[147]LDVISNDLLK Gamma sulfur oxidizers_fructose-1_6-bisphosphatase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 15 45.934 -130.0138 1450 gi|269468018|gb|EEZ79743.1| 1 4 10 QVAAGYVLYGPSTLLVMTTGK Gamma sulfur oxidizers_fructose-1_6-bisphosphatase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate metabolism;glycolysis or pentose phosphate pathway or fructose and mannaose metabolism 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 MLFEVLGDMWAVNR Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 MANTLNYLDIK Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 IIGTNLISEAFLYEEQTR Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 NPYLQEDLIK Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 M[147]LFEVLGDMWAVNR Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 ALTEALYSR Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 17 45.934 -130.0138 1450 gi|269468125|gb|EEZ79835.1| 1 7 10 MVMPDGNWLQVK Gamma sulfur oxidizers_FAD/FMN-containing dehydrogenase Unassigned 27 45.934 -130.0138 1450 gi|269468463|gb|EEZ80124.1| 1 2 10 DQALETEMLYR Gamma sulfur oxidizers_hypothetical protein Sup05_0570 Unassigned 27 45.934 -130.0138 1450 gi|269468463|gb|EEZ80124.1| 1 2 10 DQALETEM[147]LYR Gamma sulfur oxidizers_hypothetical protein Sup05_0570 Unassigned 134 45.934 -130.0138 1450 gi|118602142|ref|YP_903357.1| 0.9999 1 10 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase;beta subunit Metabolism;Energy Metabolism;Sulfur metabolism 134 45.934 -130.0138 1450 gi|148244257|ref|YP_001218951.1| 0.9999 1 10 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase;beta subunit Metabolism;Energy Metabolism;Sulfur metabolism 134 45.934 -130.0138 1450 gi|269469205|gb|EEZ80741.1| 0.9999 1 10 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase;beta subunit Metabolism;Energy Metabolism;Sulfur metabolism 134 45.934 -130.0138 1450 gi|291614177|ref|YP_003524334.1| 0.9999 1 10 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase;beta subunit Metabolism;Energy Metabolism;Sulfur metabolism 134 45.934 -130.0138 1450 gi|356960666|ref|ZP_09063648.1| 0.9999 1 10 GYADFAPLGHSVR Bacteria_adenylylsulfate reductase;beta subunit Metabolism;Energy Metabolism;Sulfur metabolism 217 45.934 -130.0138 1450 gi|148244379|ref|YP_001219073.1| 0.995 1 10 ILDVISTDAGSVK Gamma sulfur oxidizers_hypothetical protein COSY_0219 Unassigned 108a 45.934 -130.0138 1450 gi|269468628|gb|EEZ80272.1| 1 3 10 VDIPQEAFLAVLHID Gamma sulfur oxidizers_membrane GTPase LepA Unassigned 108a 45.934 -130.0138 1450 gi|269468628|gb|EEZ80272.1| 1 3 10 VFAGLFPISGEDYEK Gamma sulfur oxidizers_membrane GTPase LepA Unassigned 108a 45.934 -130.0138 1450 gi|269468628|gb|EEZ80272.1| 1 3 10 AGEVGFLIASIK Gamma sulfur oxidizers_membrane GTPase LepA Unassigned 124a 45.934 -130.0138 1450 gi|269469170|gb|EEZ80712.1| 0.9997 3 10 SVTDIWASADWYER Gamma sulfur oxidizers_NADH dehydrogenase I chain C Metabolism;Energy Metabolism;Oxidative phosphorylation 124a 45.934 -130.0138 1450 gi|269469170|gb|EEZ80712.1| 0.9997 3 10 FAVVYHLLSVSK Gamma sulfur oxidizers_NADH dehydrogenase I chain C Metabolism;Energy Metabolism;Oxidative phosphorylation 124a 45.934 -130.0138 1450 gi|269469170|gb|EEZ80712.1| 0.9997 3 10 ILTDYGFVGHPLR Gamma sulfur oxidizers_NADH dehydrogenase I chain C Metabolism;Energy Metabolism;Oxidative phosphorylation 131a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 4 10 INSQISSLFGGR Gamma sulfur oxidizers_cell division protein FtsH Unassigned 131a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 4 10 KINSQISSLFGGR Gamma sulfur oxidizers_cell division protein FtsH Unassigned 131a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 4 10 ALGVTMFLPEK Gamma sulfur oxidizers_cell division protein FtsH Unassigned 131a 45.934 -130.0138 1450 gi|356960405|ref|ZP_09063387.1| 1 4 10 NAPCIIFIDEIDAVGR Gamma sulfur oxidizers_cell division protein FtsH Unassigned 133a 45.934 -130.0138 1450 gi|71082868|ref|YP_265587.1| 1 4 10 GYLSPYFITNADK SAR11_groEL gene product Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 133a 45.934 -130.0138 1450 gi|71082868|ref|YP_265587.1| 1 4 10 VGNEGVITVEEAK SAR11_groEL gene product Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 133a 45.934 -130.0138 1450 gi|71082868|ref|YP_265587.1| 1 4 10 YVTAGMNPMDVK SAR11_groEL gene product Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 133a 45.934 -130.0138 1450 gi|71082868|ref|YP_265587.1| 1 4 10 DSGAGGMSGGMPGGMGGMGGM[147]GGM[147]GM[147] SAR11_groEL gene product Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 63a 45.934 -130.0138 1450 gi|118602839|ref|YP_904054.1| 1 2 10 LYVSAESLEER Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 63a 45.934 -130.0138 1450 gi|118602839|ref|YP_904054.1| 1 2 10 TFHALGDYDINK Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 80a 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 5 10 LFPTSVAYLLTDFLVK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 5 10 TDSFTLSEEAIAAAQK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 5 10 TVNFDVVDAQQAR Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 5 10 FGPYIQYGK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|260072656|gb|ACX30554.1| 1 5 10 HFGDIVDYK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 5 10 LFPTSVAYLLTDFLVK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 5 10 TDSFTLSEEAIAAAQK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 5 10 TVNFDVVDAQQAR Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 5 10 FGPYIQYGK Gamma sulfur oxidizers_topoisomerase IA Unassigned 80a 45.934 -130.0138 1450 gi|269468582|gb|EEZ80231.1| 1 5 10 HFGDIVDYK Gamma sulfur oxidizers_topoisomerase IA Unassigned 92a 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 4 10 LLAMFNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing;Translation;Ribosome 92a 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 4 10 LLAM[147]FNFPFK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing;Translation;Ribosome 92a 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 4 10 EILPALQK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing;Translation;Ribosome 92a 45.934 -130.0138 1450 gi|269468086|gb|EEZ79800.1| 1 4 10 ITINMGLGSALGDK Gamma sulfur oxidizers_ribosomal protein L5 Genetic Information Processing;Translation;Ribosome 98a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 4 10 AEAALAEALDAK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 98a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 4 10 GIKWDLQEGEGAFYGPK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 98a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 4 10 GWTLYQIVEQYMR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 98a 45.934 -130.0138 1450 gi|269468318|gb|EEZ79994.1| 1 4 10 FGDAMFTTSSENR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 5 45.934 -130.0138 1450 gi|118602391|ref|YP_903606.1| 1 1 9 VVEEPGAEQVFEFENGLVQLVETR Gamma sulfur oxidizers_potassium transporter peripheral membrane component Unassigned 5 45.934 -130.0138 1450 gi|269468827|gb|EEZ80431.1| 1 1 9 VVEEPGAEQVFEFENGLVQLVETR Gamma sulfur oxidizers_potassium transporter peripheral membrane component Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 EVLDAVGVGQK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 SVEEFQTPLGFPGEK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 AALDLEVSR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 AVCNNYVDMER Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 11 45.934 -130.0138 1450 gi|269467778|gb|EEZ79539.1| 1 6 9 AVCNNYVDMERSTIMESTFCCGGGGGLLTDDLMEIALK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 14 45.934 -130.0138 1450 gi|269467932|gb|EEZ79667.1| 1 3 9 FENASGLDYK Gamma sulfur oxidizers_D-alanyl-D-alanine carboxypeptidase Metabolism;Glycan Biosynthesis and Metabolism;Peptidoglycan biosynthesis 14 45.934 -130.0138 1450 gi|269467932|gb|EEZ79667.1| 1 3 9 LMTAYVVFQLIKDGR Gamma sulfur oxidizers_D-alanyl-D-alanine carboxypeptidase Metabolism;Glycan Biosynthesis and Metabolism;Peptidoglycan biosynthesis 14 45.934 -130.0138 1450 gi|269467932|gb|EEZ79667.1| 1 3 9 DFPEFYPWYSEK Gamma sulfur oxidizers_D-alanyl-D-alanine carboxypeptidase Metabolism;Glycan Biosynthesis and Metabolism;Peptidoglycan biosynthesis 20 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 9 GGELSLLAGTSIISPMK Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 20 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 9 SIEILGLDAISR Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 20 45.934 -130.0138 1450 gi|269468221|gb|EEZ79911.1| 1 3 9 GGELSLLAGTSIISPM[147]K Gamma sulfur oxidizers_outer membrane protein/protective antigen OMA87 Unassigned 26 45.934 -130.0138 1450 gi|269468409|gb|EEZ80074.1| 1 3 9 GFGFIEQESGDDVFVHFR Gamma sulfur oxidizers_cold shock protein Unassigned (chaperonin?) 26 45.934 -130.0138 1450 gi|269468409|gb|EEZ80074.1| 1 3 9 KGFGFIEQESGDDVFVHFR Gamma sulfur oxidizers_cold shock protein Unassigned (chaperonin?) 26 45.934 -130.0138 1450 gi|269468409|gb|EEZ80074.1| 1 3 9 GPQAANVHPQ Gamma sulfur oxidizers_cold shock protein Unassigned (chaperonin?) 127a 45.934 -130.0138 1450 gi|269469211|gb|EEZ80745.1| 1 5 9 NPLFLLDEIEK Gamma sulfur oxidizers_ATP-dependent Lon protease;bacterial type Unassigned 127a 45.934 -130.0138 1450 gi|269469211|gb|EEZ80745.1| 1 5 9 WIDEVLDIALEK Gamma sulfur oxidizers_ATP-dependent Lon protease;bacterial type Unassigned 127a 45.934 -130.0138 1450 gi|269469211|gb|EEZ80745.1| 1 5 9 TYIGAMPGSIVQK Gamma sulfur oxidizers_ATP-dependent Lon protease;bacterial type Unassigned 127a 45.934 -130.0138 1450 gi|269469211|gb|EEZ80745.1| 1 5 9 LNYTGQLGDVMK Gamma sulfur oxidizers_ATP-dependent Lon protease;bacterial type Unassigned 127a 45.934 -130.0138 1450 gi|269469211|gb|EEZ80745.1| 1 5 9 TVIIPDDNER Gamma sulfur oxidizers_ATP-dependent Lon protease;bacterial type Unassigned 45a 45.934 -130.0138 1450 gi|118602175|ref|YP_903390.1| 1 3 9 AVEWLGELADAAQK Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 45a 45.934 -130.0138 1450 gi|118602175|ref|YP_903390.1| 1 3 9 LSLPSTFMMPFSR Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 45a 45.934 -130.0138 1450 gi|118602175|ref|YP_903390.1| 1 3 9 DVSGLMINR Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 45a 45.934 -130.0138 1450 gi|269469152|gb|EEZ80697.1| 1 3 9 AVEWLGELADAAQK Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 45a 45.934 -130.0138 1450 gi|269469152|gb|EEZ80697.1| 1 3 9 LSLPSTFMMPFSR Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 45a 45.934 -130.0138 1450 gi|269469152|gb|EEZ80697.1| 1 3 9 DVSGLMINR Gamma sulfur oxidizers_hypothetical protein Rmag_0124 Unassigned;Cellular Processes and Signaling;Inorganic ion transport and metabolism 60a 45.934 -130.0138 1450 gi|118602772|ref|YP_903987.1| 1 2 9 GSLESTVIAVGQDAK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 60a 45.934 -130.0138 1450 gi|118602772|ref|YP_903987.1| 1 2 9 TPGSIEAIRPMK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 60a 45.934 -130.0138 1450 gi|269468196|gb|EEZ79889.1| 1 2 9 GSLESTVIAVGQDAK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 60a 45.934 -130.0138 1450 gi|269468196|gb|EEZ79889.1| 1 2 9 TPGSIEAIRPMK Gamma sulfur oxidizers_rod shape-determining protein MreB Unassigned 90a 45.934 -130.0138 1450 gi|269468042|gb|EEZ79760.1| 1 4 9 DGFSYNINADLVAGSIAEALNAEK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 90a 45.934 -130.0138 1450 gi|269468042|gb|EEZ79760.1| 1 4 9 LILLTNTSGLLDADDNLLTGLDAK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 90a 45.934 -130.0138 1450 gi|269468042|gb|EEZ79760.1| 1 4 9 VTDSETMDVVEMVLGGLVNK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 90a 45.934 -130.0138 1450 gi|269468042|gb|EEZ79760.1| 1 4 9 KVDQLIDDGTIHGGMLPK Gamma sulfur oxidizers_acetylglutamate kinase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 91a 45.934 -130.0138 1450 gi|269468078|gb|EEZ79792.1| 1 4 9 SANIALVLYADGER Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing;Translation;Ribosome 91a 45.934 -130.0138 1450 gi|269468078|gb|EEZ79792.1| 1 4 9 FVVSIVDKDLHK Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing;Translation;Ribosome 91a 45.934 -130.0138 1450 gi|269468078|gb|EEZ79792.1| 1 4 9 TYIIAPNGLK Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing;Translation;Ribosome 91a 45.934 -130.0138 1450 gi|269468078|gb|EEZ79792.1| 1 4 9 IKDDIPATVER Gamma sulfur oxidizers_ribosomal protein L2 Genetic Information Processing;Translation;Ribosome 96a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 9 MNSMPLGSAALAGTTYPINR Gamma sulfur oxidizers_argininosuccinate lyase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate or Arginine and proline metabolism 96a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 9 VYGNLTSLLTIMK Gamma sulfur oxidizers_argininosuccinate lyase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate or Arginine and proline metabolism 96a 45.934 -130.0138 1450 gi|269468206|gb|EEZ79899.1| 1 3 9 DAHEVVGQSVSYGIEHQK Gamma sulfur oxidizers_argininosuccinate lyase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate or Arginine and proline metabolism 19 45.934 -130.0138 1450 gi|269468178|gb|EEZ79877.1| 1 2 8 AVFENIIPSSTGAAK Gamma sulfur oxidizers_glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase Metabolism;Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 19 45.934 -130.0138 1450 gi|269468178|gb|EEZ79877.1| 1 2 8 GVSASSIFDANAGIALDDTFVK Gamma sulfur oxidizers_glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase Metabolism;Carbohydrate Metabolism;Glycolysis/Gluconeogenesis 30 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 ASIYNAMPQEGIDSLVSFMK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism;Energy Metabolism;Methane metabolism or Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 30 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 LMQEELLEYGNAK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism;Energy Metabolism;Methane metabolism or Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 30 45.934 -130.0138 1450 gi|269468602|gb|EEZ80246.1| 1 3 8 SWMNVPFLLANEDLNGLFLEK Gamma sulfur oxidizers_phosphoserine aminotransferase Metabolism;Energy Metabolism;Methane metabolism or Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 172 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 0.9991 4 8 IFLQQSDTVLTALDAK Methylotrophs_PQQ-dependent dehydrogenase;methanol/ethanol family Metabolism;Energy metabolism;Methane metabolism 172 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 0.9991 4 8 GFLAAYDINTGELAWK Methylotrophs_PQQ-dependent dehydrogenase;methanol/ethanol family Metabolism;Energy metabolism;Methane metabolism 172 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 0.9991 4 8 WSMSLWAR Methylotrophs_PQQ-dependent dehydrogenase;methanol/ethanol family Metabolism;Energy metabolism;Methane metabolism 172 45.934 -130.0138 1450 gi|344261379|gb|EGW21650.1| 0.9991 4 8 VITGISGGEFGVR Methylotrophs_PQQ-dependent dehydrogenase;methanol/ethanol family Metabolism;Energy metabolism;Methane metabolism 215 45.934 -130.0138 1450 gi|148244179|ref|YP_001218873.1| 0.995 1 8 DITNFLDYVGEPAK Gamma sulfur oxidizers_ubiquinol-cytochrome c reductase cytochrome c1 subunit Metabolism;Energy metabolism;Oxidative phosphorylation 240 45.934 -130.0138 1450 gi|269468867|gb|EEZ80462.1| 0.995 1 8 WLNNTDFGLNFDTK Gamma sulfur oxidizers_hypothetical protein Sup05_0003 Unassigned 240 45.934 -130.0138 1450 gi|269469067|gb|EEZ80622.1| 0.995 1 8 WLNNTDFGLNFDTK Gamma sulfur oxidizers_hypothetical protein Sup05_0003 Unassigned 122a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 8 FSMPIVTFIDTPGAYPGIGAEER Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 122a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 8 MNLDYLDFEQPIADLEGK Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 122a 45.934 -130.0138 1450 gi|269469149|gb|EEZ80694.1| 1 3 8 M[147]NLDYLDFEQPIADLEGK Gamma sulfur oxidizers_acetyl-CoA carboxylase alpha subunit Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 146a 45.934 -130.0138 1450 gi|269468609|gb|EEZ80253.1| 0.9999 2 8 IPSNSMMPTLLTGDFILVSK Gamma sulfur oxidizers_signal peptidase I Genetic Information Processing;Folding;Sorting and Degradation;Protein export 146a 45.934 -130.0138 1450 gi|269468609|gb|EEZ80253.1| 0.9999 2 8 FWGFVPEEYIIGK Gamma sulfur oxidizers_signal peptidase I Genetic Information Processing;Folding;Sorting and Degradation;Protein export 149a 45.934 -130.0138 1450 gi|357406527|ref|YP_004918451.1| 0.9999 3 8 AEAPLSEMFGYIGDLR Methylotrophs_fusA gene product Unassigned 149a 45.934 -130.0138 1450 gi|357406527|ref|YP_004918451.1| 0.9999 3 8 AGPQLIEPIMK Methylotrophs_fusA gene product Unassigned 149a 45.934 -130.0138 1450 gi|357406527|ref|YP_004918451.1| 0.9999 3 8 YGALTFIR Methylotrophs_fusA gene product Unassigned 158a 45.934 -130.0138 1450 gi|269469084|gb|EEZ80637.1| 0.9993 3 8 ALEYGMPPTAGEGIGIDR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 158a 45.934 -130.0138 1450 gi|269469084|gb|EEZ80637.1| 0.9993 3 8 LVMLFTDSPSIR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 158a 45.934 -130.0138 1450 gi|269469084|gb|EEZ80637.1| 0.9993 3 8 SQIVAYIR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 158a 45.934 -130.0138 1450 gi|269469091|gb|EEZ80642.1| 0.9993 3 8 ALEYGMPPTAGEGIGIDR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 158a 45.934 -130.0138 1450 gi|269469091|gb|EEZ80642.1| 0.9993 3 8 LVMLFTDSPSIR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 158a 45.934 -130.0138 1450 gi|269469091|gb|EEZ80642.1| 0.9993 3 8 SQIVAYIR Gamma sulfur oxidizers_lysyl-tRNA synthetase;class II Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 192a 45.934 -130.0138 1450 gi|260072537|gb|ACX30437.1| 0.996 2 8 FLALIPYTDK Gamma sulfur oxidizers_ribosomal protein S18 Genetic Information Processing;Translation;Ribosome 192a 45.934 -130.0138 1450 gi|260072537|gb|ACX30437.1| 0.996 2 8 EIDYKDVDVLLK Gamma sulfur oxidizers_ribosomal protein S18 Genetic Information Processing;Translation;Ribosome 192a 45.934 -130.0138 1450 gi|269468495|gb|EEZ80153.1| 0.996 2 8 FLALIPYTDK Gamma sulfur oxidizers_ribosomal protein S18 Genetic Information Processing;Translation;Ribosome 192a 45.934 -130.0138 1450 gi|269468495|gb|EEZ80153.1| 0.996 2 8 EIDYKDVDVLLK Gamma sulfur oxidizers_ribosomal protein S18 Genetic Information Processing;Translation;Ribosome 50a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9978 5 8 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9978 5 8 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9978 5 8 QSIVVTELPYQVNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9978 5 8 VLYAMEVLGNDYNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|118602340|ref|YP_903555.1| 0.9978 5 8 NILIDGQGNFGSVDGDSAAAM[147]R Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9978 5 8 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9978 5 8 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9978 5 8 QSIVVTELPYQVNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9978 5 8 VLYAMEVLGNDYNK Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 50a 45.934 -130.0138 1450 gi|269467763|gb|EEZ79527.1| 0.9978 5 8 NILIDGQGNFGSVDGDSAAAM[147]R Gamma sulfur oxidizers_DNA gyrase subunit A Unassigned 53a 45.934 -130.0138 1450 gi|118602464|ref|YP_903679.1| 0.9998 3 8 AGNTSLEELVMAVR Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 53a 45.934 -130.0138 1450 gi|118602464|ref|YP_903679.1| 0.9998 3 8 YTNDVEFSPEDAGR Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 53a 45.934 -130.0138 1450 gi|118602464|ref|YP_903679.1| 0.9998 3 8 LVSSVTGFIVQPNK Gamma sulfur oxidizers_2-isopropylmalate synthase Metabolism;Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 62a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 1 4 8 ILLSQVPGGMLTNMESQLR Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or Amino Acid Metabolism;Arginine and proline metabolism 62a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 1 4 8 KVEITELVFR Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or Amino Acid Metabolism;Arginine and proline metabolism 62a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 1 4 8 DMAGLLQPYVAYDLVK Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or Amino Acid Metabolism;Arginine and proline metabolism 62a 45.934 -130.0138 1450 gi|118602821|ref|YP_904036.1| 1 4 8 IFDAMNDIR Gamma sulfur oxidizers_oxaloacetate decarboxylase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism or Amino Acid Metabolism;Arginine and proline metabolism 68a 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 1 5 8 AQSTSAEAAIAALAALDSEFGR Gamma sulfur oxidizers_DNA-directed RNA polymerase sigma-70 factor Genetic Information Processing;Transcription;RNA polymerase 68a 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 1 5 8 GLQFLDLIQEGNVGLMK Gamma sulfur oxidizers_DNA-directed RNA polymerase sigma-70 factor Genetic Information Processing;Transcription;RNA polymerase 68a 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 1 5 8 IPVHMIETINK Gamma sulfur oxidizers_DNA-directed RNA polymerase sigma-70 factor Genetic Information Processing;Transcription;RNA polymerase 68a 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 1 5 8 MTDVIIGYQGDAEDFANK Gamma sulfur oxidizers_DNA-directed RNA polymerase sigma-70 factor Genetic Information Processing;Transcription;RNA polymerase 68a 45.934 -130.0138 1450 gi|148244277|ref|YP_001218971.1| 1 5 8 FSTYATWWIR Gamma sulfur oxidizers_DNA-directed RNA polymerase sigma-70 factor Genetic Information Processing;Transcription;RNA polymerase 76a 45.934 -130.0138 1450 gi|148244979|ref|YP_001219673.1| 0.9999 3 8 SFVLDEADEMLK Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 76a 45.934 -130.0138 1450 gi|148244979|ref|YP_001219673.1| 0.9999 3 8 ELAIQVSEAVQTYAR Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 76a 45.934 -130.0138 1450 gi|148244979|ref|YP_001219673.1| 0.9999 3 8 QIALFSATMPNVIK Gamma sulfur oxidizers_ATP-dependent RNA helicase DeaD Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 89a 45.934 -130.0138 1450 gi|269468026|gb|EEZ79749.1| 1 4 8 LGGYIGILQTDADSFLK Gamma sulfur oxidizers_cysteinyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 89a 45.934 -130.0138 1450 gi|269468026|gb|EEZ79749.1| 1 4 8 GLSASDAAMDEVSQR Gamma sulfur oxidizers_cysteinyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 89a 45.934 -130.0138 1450 gi|269468026|gb|EEZ79749.1| 1 4 8 DPLDFVLWK Gamma sulfur oxidizers_cysteinyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 89a 45.934 -130.0138 1450 gi|269468026|gb|EEZ79749.1| 1 4 8 VLVMFDVITR Gamma sulfur oxidizers_cysteinyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 8 45.934 -130.0138 1450 gi|148244920|ref|YP_001219614.1| 1 2 7 LILTTGTGSIFGFLVAR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrP Unassigned 8 45.934 -130.0138 1450 gi|148244920|ref|YP_001219614.1| 1 2 7 LIVAMTEYNFK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrP Unassigned 16 45.934 -130.0138 1450 gi|269468080|gb|EEZ79794.1| 1 2 7 VLNSAISNAEHNDGLDIDELK Gamma sulfur oxidizers_ribosomal protein L22 Genetic Information Processing;Translation;Ribosome 16 45.934 -130.0138 1450 gi|269468080|gb|EEZ79794.1| 1 2 7 KVLNSAISNAEHNDGLDIDELK Gamma sulfur oxidizers_ribosomal protein L22 Genetic Information Processing;Translation;Ribosome 23 45.934 -130.0138 1450 gi|269468288|gb|EEZ79970.1| 1 2 7 GFEADQISDYK Gamma sulfur oxidizers_NADH:ubiquinone oxidoreductase;chain N Metabolism;Energy Metabolism;Oxidative phosphorylation 23 45.934 -130.0138 1450 gi|269468288|gb|EEZ79970.1| 1 2 7 IAAVAMLVR Gamma sulfur oxidizers_NADH:ubiquinone oxidoreductase;chain N Metabolism;Energy Metabolism;Oxidative phosphorylation 37 45.934 -130.0138 1450 gi|269469174|gb|EEZ80716.1| 1 3 7 IVADSDIGALIQTDMTR Gamma sulfur oxidizers_NADH dehydrogenase I chain G Metabolism;Energy Metabolism;Oxidative phosphorylation 37 45.934 -130.0138 1450 gi|269469174|gb|EEZ80716.1| 1 3 7 FSYEGLSHENR Gamma sulfur oxidizers_NADH dehydrogenase I chain G Metabolism;Energy Metabolism;Oxidative phosphorylation 37 45.934 -130.0138 1450 gi|269469174|gb|EEZ80716.1| 1 3 7 DNDDVNETWISDR Gamma sulfur oxidizers_NADH dehydrogenase I chain G Metabolism;Energy Metabolism;Oxidative phosphorylation 154 45.934 -130.0138 1450 gi|148244674|ref|YP_001219368.1| 0.9997 2 7 STTAVNLALALQAEGAK Gamma sulfur oxidizers_Mrp-ATPase Unassigned 154 45.934 -130.0138 1450 gi|148244674|ref|YP_001219368.1| 0.9997 2 7 VAILDADIYGPSQPR Gamma sulfur oxidizers_Mrp-ATPase Unassigned 272 45.934 -130.0138 1450 gi|269468809|gb|EEZ80413.1| 0.9737 2 7 TIYNFCNGAWCGQSPASIR Gamma sulfur oxidizers_hypothetical protein Sup05_0849 Unassigned 272 45.934 -130.0138 1450 gi|269468809|gb|EEZ80413.1| 0.9737 2 7 GVLEVAGISR Gamma sulfur oxidizers_hypothetical protein Sup05_0849 Unassigned 102a 45.934 -130.0138 1450 gi|269468483|gb|EEZ80144.1| 1 3 7 LLEDLDSSWEVLAEPIQTVMR Gamma sulfur oxidizers_adenylosuccinate lyase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 102a 45.934 -130.0138 1450 gi|269468483|gb|EEZ80144.1| 1 3 7 TIAGEVGSSTMPHK Gamma sulfur oxidizers_adenylosuccinate lyase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 102a 45.934 -130.0138 1450 gi|269468483|gb|EEZ80144.1| 1 3 7 YGIENPYEK Gamma sulfur oxidizers_adenylosuccinate lyase Metabolism;Nucleotide metabolism;purine metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism 109a 45.934 -130.0138 1450 gi|269468819|gb|EEZ80423.1| 1 3 7 AFDQGLNPIVVINK Gamma sulfur oxidizers_membrane GTPase Unassigned 109a 45.934 -130.0138 1450 gi|269468819|gb|EEZ80423.1| 1 3 7 LLEQSQTFDDR Gamma sulfur oxidizers_membrane GTPase Unassigned 109a 45.934 -130.0138 1450 gi|269468819|gb|EEZ80423.1| 1 3 7 VLSMVDSVLLLVDAQEGPMPQTR Gamma sulfur oxidizers_membrane GTPase Unassigned 111a 45.934 -130.0138 1450 gi|269468934|gb|EEZ80518.1| 1 3 7 GPVGLEGLTSQK Gamma sulfur oxidizers_gamma-glutamyl phosphate reductase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 111a 45.934 -130.0138 1450 gi|269468934|gb|EEZ80518.1| 1 3 7 VLPELIAEYIAK Gamma sulfur oxidizers_gamma-glutamyl phosphate reductase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 111a 45.934 -130.0138 1450 gi|269468934|gb|EEZ80518.1| 1 3 7 FIVLGDGHTR Gamma sulfur oxidizers_gamma-glutamyl phosphate reductase Metabolism;Amino Acid Metabolism;Arginine and proline metabolism 129a 45.934 -130.0138 1450 gi|344259865|gb|EGW20137.1| 0.9997 2 7 MFDGSSVAGWK Methylotrophs_glutamine synthetase;type I Metabolism;Carbohydrate Metabolism;Glyoxylate and dicarboxylate metabolism or Energy Metabolism;Nitrogen metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or Arginine and proline metabolism 129a 45.934 -130.0138 1450 gi|344259865|gb|EGW20137.1| 0.9997 2 7 ADEVLELK Methylotrophs_glutamine synthetase;type I Metabolism;Carbohydrate Metabolism;Glyoxylate and dicarboxylate metabolism or Energy Metabolism;Nitrogen metabolism or Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or Arginine and proline metabolism 130a 45.934 -130.0138 1450 gi|344262284|gb|EGW22555.1| 1 3 7 TIAVLTHDSIGQGEDGPTHQPIENTSAMR Methylotrophs_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 130a 45.934 -130.0138 1450 gi|344262284|gb|EGW22555.1| 1 3 7 VVSMPSTNVFDR Methylotrophs_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 130a 45.934 -130.0138 1450 gi|344262284|gb|EGW22555.1| 1 3 7 EMGNYISYGVR Methylotrophs_transketolase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or Metabolism of Terpenoids and Polyketides;Biosynthesis of ansamycins 142a 45.934 -130.0138 1450 gi|118602834|ref|YP_904049.1| 0.9999 3 7 LGADVLLTTR Gamma sulfur oxidizers_putative glutamate synthase (NADPH) small subunit Unassigned 142a 45.934 -130.0138 1450 gi|118602834|ref|YP_904049.1| 0.9999 3 7 LVNVDNVLGNFDER Gamma sulfur oxidizers_putative glutamate synthase (NADPH) small subunit Unassigned 142a 45.934 -130.0138 1450 gi|118602834|ref|YP_904049.1| 0.9999 3 7 VICIGGGDTSIDVVSVAR Gamma sulfur oxidizers_putative glutamate synthase (NADPH) small subunit Unassigned 160a 45.934 -130.0138 1450 gi|357404221|ref|YP_004916145.1| 0.9995 3 7 GAEYVVDFLPK Methylotrophs_glnK gene product Unassigned 160a 45.934 -130.0138 1450 gi|357404221|ref|YP_004916145.1| 0.9995 3 7 IFVTSLEQVIR Methylotrophs_glnK gene product Unassigned 160a 45.934 -130.0138 1450 gi|357404221|ref|YP_004916145.1| 0.9995 3 7 LITAIIKPFK Methylotrophs_glnK gene product Unassigned 43a 45.934 -130.0138 1450 gi|118602099|ref|YP_903314.1| 1 3 7 FEDGVVYRE Gamma sulfur oxidizers_cytochrome c oxidase;cbb3-type;subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 43a 45.934 -130.0138 1450 gi|118602099|ref|YP_903314.1| 1 3 7 YGHFSLAVESK Gamma sulfur oxidizers_cytochrome c oxidase;cbb3-type;subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 43a 45.934 -130.0138 1450 gi|118602099|ref|YP_903314.1| 1 3 7 YDHPFQWGSK Gamma sulfur oxidizers_cytochrome c oxidase;cbb3-type;subunit II Metabolism;Energy Metabolism;Oxidative phosphorylation 49a 45.934 -130.0138 1450 gi|118602264|ref|YP_903479.1| 1 3 7 MVSSGTEATMSAIR Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 49a 45.934 -130.0138 1450 gi|118602264|ref|YP_903479.1| 1 3 7 VIGGGLPVGAFGGK Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 49a 45.934 -130.0138 1450 gi|118602264|ref|YP_903479.1| 1 3 7 TVIPGGVNSPVR Gamma sulfur oxidizers_glutamate-1-semialdehyde aminotransferase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 FATSDLNDLYR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 GDVVSDGPSNPHDILR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 GLMAKPDGSIIETPITSNFR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 LLELDAPEIIVR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 M[147]ALELFKPFIYNR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 VLYFEAFLVTDPGSTPLVHK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 GHKIGVGEAVGVIAAQSIGEPGTQLTMR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 LGLLMDMTLK Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 VADLFEAR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 61b 45.934 -130.0138 1450 gi|269469117|gb|EEZ80665.1| 1 10 7 TSDITGGLPR Gamma sulfur oxidizers_DNA-directed RNA polymerase;beta' subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 GLQFLDLIQEGNVGLMK Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 IPVHMIETINK Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 EIEAGVFEIMK Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 EATPEELAVEMELPEYK Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 FSTYATWWIR Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 68b 45.934 -130.0138 1450 gi|269468904|gb|EEZ80491.1| 0.9999 6 7 FGIDMNTDHTLEEVGR Gamma sulfur oxidizers_DNA-directed RNA polymerase;sigma subunit Genetic Information Processing;Transcription;RNA polymerase 71a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 1 4 7 WINSGGLGTMGFGLPAAMGAK Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism;Amino Acid;Carbohydrate;or Vitamins and Cofactors 71a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 1 4 7 IINLNNGYLGMVR Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism;Amino Acid;Carbohydrate;or Vitamins and Cofactors 71a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 1 4 7 IINLNNGYLGM[147]VR Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism;Amino Acid;Carbohydrate;or Vitamins and Cofactors 71a 45.934 -130.0138 1450 gi|148244560|ref|YP_001219254.1| 1 4 7 LAESYGHIGIK Gamma sulfur oxidizers_acetolactate synthase large subunit Metabolism;Amino Acid;Carbohydrate;or Vitamins and Cofactors 81a 45.934 -130.0138 1450 gi|260072683|gb|ACX30580.1| 1 4 7 DNIHNAYLDAFK Gamma sulfur oxidizers_AICAR transformylase/IMP cyclohydrolase PurH Metabolism;Nucleotide Metabolism;Purine metabolism or Metabolism of Cofactors and Vitamins;One carbon pool by folate 81a 45.934 -130.0138 1450 gi|260072683|gb|ACX30580.1| 1 4 7 GEDGFSNTMNLQFNK Gamma sulfur oxidizers_AICAR transformylase/IMP cyclohydrolase PurH Metabolism;Nucleotide Metabolism;Purine metabolism or Metabolism of Cofactors and Vitamins;One carbon pool by folate 81a 45.934 -130.0138 1450 gi|260072683|gb|ACX30580.1| 1 4 7 NEMTIGVGAGQMSR Gamma sulfur oxidizers_AICAR transformylase/IMP cyclohydrolase PurH Metabolism;Nucleotide Metabolism;Purine metabolism or Metabolism of Cofactors and Vitamins;One carbon pool by folate 81a 45.934 -130.0138 1450 gi|260072683|gb|ACX30580.1| 1 4 7 TDPTSAFGGIIAFNR Gamma sulfur oxidizers_AICAR transformylase/IMP cyclohydrolase PurH Metabolism;Nucleotide Metabolism;Purine metabolism or Metabolism of Cofactors and Vitamins;One carbon pool by folate 10 45.934 -130.0138 1450 gi|260072571|gb|ACX30471.1| 1 3 6 MGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 10 45.934 -130.0138 1450 gi|260072571|gb|ACX30471.1| 1 3 6 KMGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 10 45.934 -130.0138 1450 gi|260072571|gb|ACX30471.1| 1 3 6 MSGDM[147]ATMNNSMSGMR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 10 45.934 -130.0138 1450 gi|269467995|gb|EEZ79723.1| 1 3 6 MGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 10 45.934 -130.0138 1450 gi|269467995|gb|EEZ79723.1| 1 3 6 KMGDDFANVAR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 10 45.934 -130.0138 1450 gi|269467995|gb|EEZ79723.1| 1 3 6 MSGDM[147]ATMNNSMSGMR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC13F180035 Unassigned 25 45.934 -130.0138 1450 gi|269468401|gb|EEZ80066.1| 1 2 6 ETSSMIINQPLDTVEMR Gamma sulfur oxidizers_ribosomal protein S9 Genetic Information Processing;Translation;Ribosome 25 45.934 -130.0138 1450 gi|269468401|gb|EEZ80066.1| 1 2 6 ETSSM[147]IINQPLDTVEMR Gamma sulfur oxidizers_ribosomal protein S9 Genetic Information Processing;Translation;Ribosome 138 45.934 -130.0138 1450 gi|269468480|gb|EEZ80141.1| 0.9999 2 6 AGNTLFYQLNGPMSFGSAK Gamma sulfur oxidizers_sulfate permease family protein Unassigned 138 45.934 -130.0138 1450 gi|269468480|gb|EEZ80141.1| 0.9999 2 6 HFLENIGIDK Gamma sulfur oxidizers_sulfate permease family protein Unassigned 212 45.934 -130.0138 1450 gi|118602820|ref|YP_904035.1| 0.995 1 6 INPLIGSAGVSAVPMAAR Gamma sulfur oxidizers_sodium ion-translocating decarboxylase;beta subunit Metabolism;Carbohydrate metabolism;Pyruvate metabolism 212 45.934 -130.0138 1450 gi|148244909|ref|YP_001219603.1| 0.995 1 6 INPLIGSAGVSAVPMAAR Gamma sulfur oxidizers_sodium ion-translocating decarboxylase;beta subunit Metabolism;Carbohydrate metabolism;Pyruvate metabolism 213 45.934 -130.0138 1450 gi|118602837|ref|YP_904052.1| 0.995 1 6 DYFEEYQIAPAVR Gamma sulfur oxidizers_DsrC family protein Genetic Information Processing;Folding;sorting and degradation;Sulfur relay system 213 45.934 -130.0138 1450 gi|269467776|gb|EEZ79537.1| 0.995 1 6 DYFEEYQIAPAVR Gamma sulfur oxidizers_DsrC family protein Genetic Information Processing;Folding;sorting and degradation;Sulfur relay system 232 45.934 -130.0138 1450 gi|269468013|gb|EEZ79738.1| 0.995 1 6 MDFTQSELDTIQK Gamma sulfur oxidizers_hypothetical protein Sup05_0126 Unassigned 277 45.934 -130.0138 1450 gi|344259416|gb|EGW19689.1| 0.9637 1 6 QAVQMFGPAQR Methylotrophs_formaldehyde-activating enzyme Metabolism;Energy metabolism;Methane metabolism 277 45.934 -130.0138 1450 gi|357404214|ref|YP_004916138.1| 0.9637 1 6 QAVQMFGPAQR Methylotrophs_formaldehyde-activating enzyme Metabolism;Energy metabolism;Methane metabolism 277 45.934 -130.0138 1450 gi|357405773|ref|YP_004917697.1| 0.9637 1 6 QAVQMFGPAQR Methylotrophs_formaldehyde-activating enzyme Metabolism;Energy metabolism;Methane metabolism 282 45.934 -130.0138 1450 gi|269467937|gb|EEZ79672.1| 0.9599 1 6 DAGFLPEALLNYLVR Gamma sulfur oxidizers_Glutamyl- and glutaminyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 286 45.934 -130.0138 1450 gi|269468358|gb|EEZ80029.1| 0.9552 1 6 IINGALNQTLSR Gamma sulfur oxidizers_preprotein translocase subunit SecF Genetic Information Processing;Folding;sorting and degradation;Protein export 117b 45.934 -130.0138 1450 gi|148245100|ref|YP_001219794.1| 0.9928 2 6 LHLPIIGIVDTNHNPEGIDYVIPGNDDSIR Gamma sulfur oxidizers_30S ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 117b 45.934 -130.0138 1450 gi|148245100|ref|YP_001219794.1| 0.9928 2 6 WLGGMMTNYK Gamma sulfur oxidizers_30S ribosomal protein S2 Genetic Information Processing;Translation;Ribosome 145a 45.934 -130.0138 1450 gi|269468306|gb|EEZ79985.1| 0.9999 3 6 EGVLAGLGGFGAMFELPINK Gamma sulfur oxidizers_phosphoribosylaminoimidazole (AIR) synthetase Metabolism;Nucleotide Metabolism;Purine metabolism 145a 45.934 -130.0138 1450 gi|269468306|gb|EEZ79985.1| 0.9999 3 6 VTSGDHIIALGSSGPHSNGYSLIR Gamma sulfur oxidizers_phosphoribosylaminoimidazole (AIR) synthetase Metabolism;Nucleotide Metabolism;Purine metabolism 145a 45.934 -130.0138 1450 gi|269468306|gb|EEZ79985.1| 0.9999 3 6 NPVLISGTDGVGTK Gamma sulfur oxidizers_phosphoribosylaminoimidazole (AIR) synthetase Metabolism;Nucleotide Metabolism;Purine metabolism 148a 45.934 -130.0138 1450 gi|302879450|ref|YP_003848014.1| 0.9999 2 6 DYLTDLFPILELGTSAK Iron oxidizers_isocitrate dehydrogenase Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) or Metabolism of Other Amino Acids;Glutathione metabolism 148a 45.934 -130.0138 1450 gi|302879450|ref|YP_003848014.1| 0.9999 2 6 VLGSAVNPVLR Iron oxidizers_isocitrate dehydrogenase Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) or Metabolism of Other Amino Acids;Glutathione metabolism 152a 45.934 -130.0138 1450 gi|269467769|gb|EEZ79530.1| 0.9998 3 6 IAIIGSGPAGLAAADELNK Gamma sulfur oxidizers_NADPH-dependent glutamate synthase beta chain Metabolism;Energy Metabolism;Oxidative phosphorylation 152a 45.934 -130.0138 1450 gi|269467769|gb|EEZ79530.1| 0.9998 3 6 IGGLLMYGIPNMK Gamma sulfur oxidizers_NADPH-dependent glutamate synthase beta chain Metabolism;Energy Metabolism;Oxidative phosphorylation 152a 45.934 -130.0138 1450 gi|269467769|gb|EEZ79530.1| 0.9998 3 6 ADNNPWPLWPLIYR Gamma sulfur oxidizers_NADPH-dependent glutamate synthase beta chain Metabolism;Energy Metabolism;Oxidative phosphorylation 166a 45.934 -130.0138 1450 gi|269469222|gb|EEZ80753.1| 0.9995 3 6 MVGGQSSYLPLK Gamma sulfur oxidizers_preprotein translocase subunit SecY Genetic Information Processing;Folding;Sorting and Degradation;Protein export 166a 45.934 -130.0138 1450 gi|269469222|gb|EEZ80753.1| 0.9995 3 6 M[147]VGGQSSYLPLK Gamma sulfur oxidizers_preprotein translocase subunit SecY Genetic Information Processing;Folding;Sorting and Degradation;Protein export 166a 45.934 -130.0138 1450 gi|269469222|gb|EEZ80753.1| 0.9995 3 6 MSQTLGLSEDLSK Gamma sulfur oxidizers_preprotein translocase subunit SecY Genetic Information Processing;Folding;Sorting and Degradation;Protein export 292a 45.934 -130.0138 1450 gi|118602617|ref|YP_903832.1| 0.9485 2 6 M[147]NLEM[147]AATNEM[147]ITIASK Gamma sulfur oxidizers_pyridoxine 5'-phosphate synthase Metabolism;Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 292a 45.934 -130.0138 1450 gi|118602617|ref|YP_903832.1| 0.9485 2 6 SGADSITLHLR Gamma sulfur oxidizers_pyridoxine 5'-phosphate synthase Metabolism;Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 50b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9891 5 6 NILIDGQGNFGSVDGDSAAAMR Gamma sulfur oxidizers_DNA gyrase subunit A GyrA Unassigned 50b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9891 5 6 YHPHGDTAVYDTIVR Gamma sulfur oxidizers_DNA gyrase subunit A GyrA Unassigned 50b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9891 5 6 VLYAM[147]DVLGNDYNK Gamma sulfur oxidizers_DNA gyrase subunit A GyrA Unassigned 50b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9891 5 6 NILIDGQGNFGSVDGDSAAAM[147]R Gamma sulfur oxidizers_DNA gyrase subunit A GyrA Unassigned 50b 45.934 -130.0138 1450 gi|148244447|ref|YP_001219141.1| 0.9891 5 6 KGGIIAIELR Gamma sulfur oxidizers_DNA gyrase subunit A GyrA Unassigned 87a 45.934 -130.0138 1450 gi|269468016|gb|EEZ79741.1| 1 3 6 MNVILLGPPGAGK Gamma sulfur oxidizers_adenylate kinase Metabolism;Nucleotide Metabolism;Purine metabolism 87a 45.934 -130.0138 1450 gi|269468016|gb|EEZ79741.1| 1 3 6 VM[147]DAGGLVSDDIIIGLVK Gamma sulfur oxidizers_adenylate kinase Metabolism;Nucleotide Metabolism;Purine metabolism 87a 45.934 -130.0138 1450 gi|269468016|gb|EEZ79741.1| 1 3 6 VMDAGGLVSDDIIIGLVK Gamma sulfur oxidizers_adenylate kinase Metabolism;Nucleotide Metabolism;Purine metabolism 97a 45.934 -130.0138 1450 gi|269468310|gb|EEZ79989.1| 1 4 6 LMQQADVILYDR Gamma sulfur oxidizers_uroporphyrinogen-III methylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 97a 45.934 -130.0138 1450 gi|269468310|gb|EEZ79989.1| 1 4 6 SPIVIAISSAGK Gamma sulfur oxidizers_uroporphyrinogen-III methylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 97a 45.934 -130.0138 1450 gi|269468310|gb|EEZ79989.1| 1 4 6 LVSDGVMELVR Gamma sulfur oxidizers_uroporphyrinogen-III methylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 97a 45.934 -130.0138 1450 gi|269468310|gb|EEZ79989.1| 1 4 6 DNHAVPQGDINQLLVDLAK Gamma sulfur oxidizers_uroporphyrinogen-III methylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 99a 45.934 -130.0138 1450 gi|269468322|gb|EEZ79998.1| 1 3 6 ITLSNPISADMSTMR Gamma sulfur oxidizers_phenylalanyl-tRNA synthetase beta subunit Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 99a 45.934 -130.0138 1450 gi|269468322|gb|EEZ79998.1| 1 3 6 IPADLIEELAR Gamma sulfur oxidizers_phenylalanyl-tRNA synthetase beta subunit Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 99a 45.934 -130.0138 1450 gi|269468322|gb|EEZ79998.1| 1 3 6 NYGLHTESSLR Gamma sulfur oxidizers_phenylalanyl-tRNA synthetase beta subunit Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 13 45.934 -130.0138 1450 gi|269467813|gb|EEZ79565.1| 1 1 5 SELIDAIASAANLSK Gamma sulfur oxidizers_histone family protein Unassigned 150 45.934 -130.0138 1450 gi|269468052|gb|EEZ79770.1| 0.9998 2 5 ENFVTDNGNLILDVEGLK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or carbohydrate metabolism;pentose phosphate pathway 150 45.934 -130.0138 1450 gi|269468052|gb|EEZ79770.1| 0.9998 2 5 TMGDFPLPVEVIPMAANYVK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or carbohydrate metabolism;pentose phosphate pathway 150 45.934 -130.0138 1450 gi|269468267|gb|EEZ79951.1| 0.9998 2 5 ENFVTDNGNLILDVEGLK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or carbohydrate metabolism;pentose phosphate pathway 150 45.934 -130.0138 1450 gi|269468267|gb|EEZ79951.1| 0.9998 2 5 TMGDFPLPVEVIPMAANYVK Gamma sulfur oxidizers_ribose 5-phosphate isomerase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or carbohydrate metabolism;pentose phosphate pathway 179 45.934 -130.0138 1450 gi|269468494|gb|EEZ80152.1| 0.9988 2 5 HYEIALIVHPDQSAQVGTMMDK Gamma sulfur oxidizers_ribosomal protein S6 Genetic Information Processing;Translation;Ribosome 179 45.934 -130.0138 1450 gi|269468494|gb|EEZ80152.1| 0.9988 2 5 YKEMITADGGNIHR Gamma sulfur oxidizers_ribosomal protein S6 Genetic Information Processing;Translation;Ribosome 191 45.934 -130.0138 1450 gi|118603009|ref|YP_904224.1| 0.9971 2 5 IESGLLAAER Gamma sulfur oxidizers_ATP synthase F0;B subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 191 45.934 -130.0138 1450 gi|118603009|ref|YP_904224.1| 0.9971 2 5 RIESGLLAAER Gamma sulfur oxidizers_ATP synthase F0;B subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 195 45.934 -130.0138 1450 gi|118602840|ref|YP_904055.1| 0.9962 2 5 VFFYHDGVNNASR Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 195 45.934 -130.0138 1450 gi|118602840|ref|YP_904055.1| 0.9962 2 5 NVVNQWAELDIK Gamma sulfur oxidizers_DsrE family protein Genetic Information Processing;Folding;Sorting and Degradation;Sulfur relay system 200 45.934 -130.0138 1450 gi|118602152|ref|YP_903367.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 200 45.934 -130.0138 1450 gi|148244267|ref|YP_001218961.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 200 45.934 -130.0138 1450 gi|269467958|gb|EEZ79690.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 200 45.934 -130.0138 1450 gi|269468025|gb|EEZ79748.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 200 45.934 -130.0138 1450 gi|344263257|gb|EGW23528.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 200 45.934 -130.0138 1450 gi|357407283|ref|YP_004919207.1| 0.995 1 5 HQVVNDLPLGR Bacteria_alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen Unassigned 225 45.934 -130.0138 1450 gi|260072676|gb|ACX30573.1| 0.995 1 5 TQVVVIGSGPGGYTAAFR Gamma sulfur oxidizers_pyruvate dehydrogenase complex E3 component Metabolism;Carbohydrate metabolism;Citrate cycle (TCA cycle) 231 45.934 -130.0138 1450 gi|269467939|gb|EEZ79674.1| 0.995 1 5 ALAPVLDEIADEYDGK Gamma sulfur oxidizers_thioredoxin Unassigned 241 45.934 -130.0138 1450 gi|269468979|gb|EEZ80555.1| 0.995 1 5 SVGLNAIILSVLYK Gamma sulfur oxidizers_DNA segregation ATPase FtsK/SpoIIIE Unassigned 261 45.934 -130.0138 1450 gi|269467900|gb|EEZ79639.1| 0.99 3 5 APFDMWEPK Gamma sulfur oxidizers_molecular chaperone;HSP90 family Unassigned 261 45.934 -130.0138 1450 gi|269467900|gb|EEZ79639.1| 0.99 3 5 DIYYVTAETYAAAK Gamma sulfur oxidizers_molecular chaperone;HSP90 family Unassigned 261 45.934 -130.0138 1450 gi|269467900|gb|EEZ79639.1| 0.99 3 5 GVIDTADLSLNVSR Gamma sulfur oxidizers_molecular chaperone;HSP90 family Unassigned 262 45.934 -130.0138 1450 gi|269467871|gb|EEZ79614.1| 0.9896 1 5 AESDNLYVSIDQMVNK Gamma sulfur oxidizers_ribosome-associated protein Y Genetic Information Processing;Translation;Ribosome 273 45.934 -130.0138 1450 gi|357403889|ref|YP_004915813.1| 0.9723 3 5 LADLIYDPDSR Methylotrophs_pmoB gene product Metabolism;Energy Metabolism;methane metabolism or nitrogen metabolism 273 45.934 -130.0138 1450 gi|357403889|ref|YP_004915813.1| 0.9723 3 5 AGSWIGGQLVPR Methylotrophs_pmoB gene product Metabolism;Energy Metabolism;methane metabolism or nitrogen metabolism 273 45.934 -130.0138 1450 gi|357403889|ref|YP_004915813.1| 0.9723 3 5 YPVTTPLQAGLMR Methylotrophs_pmoB gene product Metabolism;Energy Metabolism;methane metabolism or nitrogen metabolism 275 45.934 -130.0138 1450 gi|269468885|gb|EEZ80477.1| 0.9702 1 5 FNTQIGVEDKR Gamma sulfur oxidizers_phosphatidylserine synthase Metabolism;Lipid Metabolism;Glycerophospholipid metabolism or Amino Acid Metabolism;Glycine;serine and threonine metabolism 141a 45.934 -130.0138 1450 gi|118602796|ref|YP_904011.1| 0.9996 2 5 SDYPNQVNNVLGFPFIFR Gamma sulfur oxidizers_malate dehydrogenase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism 141a 45.934 -130.0138 1450 gi|118602796|ref|YP_904011.1| 0.9996 2 5 AVFDAAVSSGVSR Gamma sulfur oxidizers_malate dehydrogenase Metabolism;Carbohydrate Metabolism;Pyruvate metabolism 144a 45.934 -130.0138 1450 gi|260072678|gb|ACX30575.1| 0.9999 3 5 SVTTILDVPLFR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 144a 45.934 -130.0138 1450 gi|260072678|gb|ACX30575.1| 0.9999 3 5 ESTEINQGLTLIDK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 144a 45.934 -130.0138 1450 gi|260072678|gb|ACX30575.1| 0.9999 3 5 TTAILVSLK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 144a 45.934 -130.0138 1450 gi|269468437|gb|EEZ80102.1| 0.9999 3 5 SVTTILDVPLFR Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 144a 45.934 -130.0138 1450 gi|269468437|gb|EEZ80102.1| 0.9999 3 5 ESTEINQGLTLIDK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 144a 45.934 -130.0138 1450 gi|269468437|gb|EEZ80102.1| 0.9999 3 5 TTAILVSLK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC65E210020 Unassigned 157a 45.934 -130.0138 1450 gi|269467887|gb|EEZ79626.1| 0.9997 2 5 TYGVGAQILSDLGVK Gamma sulfur oxidizers_3_4-dihydroxy-2-butanone 4-phosphate synthase Metabolism;Metabolism of Cofactors and Vitamins;Riboflavin metabolism 157a 45.934 -130.0138 1450 gi|269467887|gb|EEZ79626.1| 0.9997 2 5 WGTIEDLISYR Gamma sulfur oxidizers_3_4-dihydroxy-2-butanone 4-phosphate synthase Metabolism;Metabolism of Cofactors and Vitamins;Riboflavin metabolism 159a 45.934 -130.0138 1450 gi|344262811|gb|EGW23082.1| 0.9981 2 5 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 159a 45.934 -130.0138 1450 gi|344262811|gb|EGW23082.1| 0.9981 2 5 TPGCSYLAGPDDIYVSPSQIR Methylotrophs_transcription termination factor Rho Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 159a 45.934 -130.0138 1450 gi|357407277|ref|YP_004919201.1| 0.9981 2 5 DVVILLDSITR Methylotrophs_transcription termination factor Rho Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 159a 45.934 -130.0138 1450 gi|357407277|ref|YP_004919201.1| 0.9981 2 5 TPGCSYLAGPDDIYVSPSQIR Methylotrophs_transcription termination factor Rho Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 163a 45.934 -130.0138 1450 gi|148244183|ref|YP_001218877.1| 0.9132 2 5 ENQTLASITFQNYFR Gamma sulfur oxidizers_preprotein translocase SecA subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 163a 45.934 -130.0138 1450 gi|148244183|ref|YP_001218877.1| 0.9132 2 5 HLLEYDDVANDQR Gamma sulfur oxidizers_preprotein translocase SecA subunit Genetic Information Processing;Folding;Sorting and Degradation;Protein export 183a 45.934 -130.0138 1450 gi|269468354|gb|EEZ80025.1| 0.9986 3 5 GTTSEQIVQMAR Gamma sulfur oxidizers_glutamine phosphoribosylpyrophosphate amidotransferase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or nucleotide metabolism;purine metabolism 183a 45.934 -130.0138 1450 gi|269468354|gb|EEZ80025.1| 0.9986 3 5 DIEPGEAVVIDR Gamma sulfur oxidizers_glutamine phosphoribosylpyrophosphate amidotransferase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or nucleotide metabolism;purine metabolism 183a 45.934 -130.0138 1450 gi|269468354|gb|EEZ80025.1| 0.9986 3 5 VFFASAAPPVR Gamma sulfur oxidizers_glutamine phosphoribosylpyrophosphate amidotransferase Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or nucleotide metabolism;purine metabolism 188a 45.934 -130.0138 1450 gi|269468903|gb|EEZ80490.1| 0.9923 3 5 ITAVVPYFGYSR Gamma sulfur oxidizers_phosphoribosylpyrophosphate synthetase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or nucleotide metabolism;purine metabolism 188a 45.934 -130.0138 1450 gi|269468903|gb|EEZ80490.1| 0.9923 3 5 QLSIAPTLAEVIK Gamma sulfur oxidizers_phosphoribosylpyrophosphate synthetase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or nucleotide metabolism;purine metabolism 188a 45.934 -130.0138 1450 gi|269468903|gb|EEZ80490.1| 0.9923 3 5 FSDGESQVEILENVR Gamma sulfur oxidizers_phosphoribosylpyrophosphate synthetase Metabolism;Carbohydrate Metabolism;Pentose phosphate pathway or nucleotide metabolism;purine metabolism 59a 45.934 -130.0138 1450 gi|118602753|ref|YP_903968.1| 1 3 5 IISLGEGNTPLIR Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 59a 45.934 -130.0138 1450 gi|118602753|ref|YP_903968.1| 1 3 5 AIICASTGNTSASAAAYAAR Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 59a 45.934 -130.0138 1450 gi|118602753|ref|YP_903968.1| 1 3 5 AFVLIPEGK Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 59a 45.934 -130.0138 1450 gi|269468121|gb|EEZ79831.1| 1 3 5 IISLGEGNTPLIR Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 59a 45.934 -130.0138 1450 gi|269468121|gb|EEZ79831.1| 1 3 5 AIICASTGNTSASAAAYAAR Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 59a 45.934 -130.0138 1450 gi|269468121|gb|EEZ79831.1| 1 3 5 AFVLIPEGK Gamma sulfur oxidizers_L-threonine synthase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Metabolism of Cofactors and Vitamins;Vitamin B6 metabolism 85c 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9555 5 5 VAGAVGFNVR Iron oxidizers_adenylylsulfate reductase;subunit alpha Metabolism;Energy metabolism;Sulfur metabolism 85c 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9555 5 5 WQIMIHGESYKPIVAEAAK Iron oxidizers_adenylylsulfate reductase;subunit alpha Metabolism;Energy metabolism;Sulfur metabolism 85c 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9555 5 5 FLTSESVFHHTLFRK Iron oxidizers_adenylylsulfate reductase;subunit alpha Metabolism;Energy metabolism;Sulfur metabolism 85c 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9555 5 5 EDLAFDMAR Iron oxidizers_adenylylsulfate reductase;subunit alpha Metabolism;Energy metabolism;Sulfur metabolism 85c 45.934 -130.0138 1450 gi|291614178|ref|YP_003524335.1| 0.9555 5 5 SGAVAQGLYAINCYMGTR Iron oxidizers_adenylylsulfate reductase;subunit alpha Metabolism;Energy metabolism;Sulfur metabolism 93a 45.934 -130.0138 1450 gi|269468151|gb|EEZ79855.1| 1 2 5 GIDTVLAEIR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing;Translation;Ribosome 93a 45.934 -130.0138 1450 gi|269468151|gb|EEZ79855.1| 1 2 5 FWVESENR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing;Translation;Ribosome 93a 45.934 -130.0138 1450 gi|269468485|gb|EEZ80146.1| 1 2 5 GIDTVLAEIR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing;Translation;Ribosome 93a 45.934 -130.0138 1450 gi|269468485|gb|EEZ80146.1| 1 2 5 FWVESENR Gamma sulfur oxidizers_ribosomal protein L28 Genetic Information Processing;Translation;Ribosome 36 45.934 -130.0138 1450 gi|269469120|gb|EEZ80668.1| 1 3 4 KVVVEQVNSLADSAISVGVAEYR Gamma sulfur oxidizers_ribosomal protein L10 Genetic Information Processing;Translation;Ribosome 36 45.934 -130.0138 1450 gi|269469120|gb|EEZ80668.1| 1 3 4 VVVEQVNSLADSAISVGVAEYR Gamma sulfur oxidizers_ribosomal protein L10 Genetic Information Processing;Translation;Ribosome 36 45.934 -130.0138 1450 gi|269469120|gb|EEZ80668.1| 1 3 4 DQAISLVMALMLAPVEK Gamma sulfur oxidizers_ribosomal protein L10 Genetic Information Processing;Translation;Ribosome 38 45.934 -130.0138 1450 gi|357404814|ref|YP_004916738.1| 1 1 4 YTNILMGTVQAAIANGVLDAVR Methylotrophs_fae gene product Metabolism;Energy metabolism;Methane metabolism 135 45.934 -130.0138 1450 gi|118602610|ref|YP_903825.1| 0.9999 2 4 QFFDVLLVDTAGR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 135 45.934 -130.0138 1450 gi|118602610|ref|YP_903825.1| 0.9999 2 4 LLGMGDVLSLVEEISR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 135 45.934 -130.0138 1450 gi|148244704|ref|YP_001219398.1| 0.9999 2 4 QFFDVLLVDTAGR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 135 45.934 -130.0138 1450 gi|148244704|ref|YP_001219398.1| 0.9999 2 4 LLGMGDVLSLVEEISR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 135 45.934 -130.0138 1450 gi|269468630|gb|EEZ80274.1| 0.9999 2 4 QFFDVLLVDTAGR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 135 45.934 -130.0138 1450 gi|269468630|gb|EEZ80274.1| 0.9999 2 4 LLGMGDVLSLVEEISR Gamma sulfur oxidizers_signal recognition particle subunit FFH/SRP54 (srp54) Genetic Information Processing;Folding;Sorting and Degradation;Protein export 137 45.934 -130.0138 1450 gi|269468320|gb|EEZ79996.1| 0.9999 1 4 VLSDIAIFDKPAFAQIADQAK Gamma sulfur oxidizers_ribosomal protein L20 Genetic Information Processing;Translation;Ribosome 139 45.934 -130.0138 1450 gi|356960153|ref|ZP_09063135.1| 0.9999 2 4 AVNDNTSAAGIGITGK Gamma sulfur oxidizers_extracellular solute-binding protein Unassigned 139 45.934 -130.0138 1450 gi|356960153|ref|ZP_09063135.1| 0.9999 2 4 SMTLAAAGDPVGLAYIGSR Gamma sulfur oxidizers_extracellular solute-binding protein Unassigned 155 45.934 -130.0138 1450 gi|269468174|gb|EEZ79873.1| 0.9997 2 4 NEVVEDGDLVVLTK Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 155 45.934 -130.0138 1450 gi|269468174|gb|EEZ79873.1| 0.9997 2 4 AEVFDVANAVLDGTDAVMLSAETAAGDYPENAVK Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 161 45.934 -130.0138 1450 gi|269467872|gb|EEZ79615.1| 0.9996 2 4 MDAVSQESNELSAK Gamma sulfur oxidizers_hypothetical protein Sup05_0945 Unassigned 161 45.934 -130.0138 1450 gi|269467872|gb|EEZ79615.1| 0.9996 2 4 IALQNTFK Gamma sulfur oxidizers_hypothetical protein Sup05_0945 Unassigned 171 45.934 -130.0138 1450 gi|269469133|gb|EEZ80678.1| 0.9991 2 4 TTDAQIGGFLVGLSMK Gamma sulfur oxidizers_anthranilate phosphoribosyltransferase Metabolism;Amino Acid Metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis 171 45.934 -130.0138 1450 gi|269469133|gb|EEZ80678.1| 0.9991 2 4 SGSADVLEAAGVNLDMSPEK Gamma sulfur oxidizers_anthranilate phosphoribosyltransferase Metabolism;Amino Acid Metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis 174 45.934 -130.0138 1450 gi|356960519|ref|ZP_09063501.1| 0.9991 2 4 LAEIAGQYLDK Gamma sulfur oxidizers_single-strand binding protein Genetic Information Processing;Replication and Repair;DNA replication or mismatch repair or homologous recombination 174 45.934 -130.0138 1450 gi|356960519|ref|ZP_09063501.1| 0.9991 2 4 VILVGNLGAKPEVK Gamma sulfur oxidizers_single-strand binding protein Genetic Information Processing;Replication and Repair;DNA replication or mismatch repair or homologous recombination 194 45.934 -130.0138 1450 gi|269469110|gb|EEZ80658.1| 0.9964 2 4 FDFLGLSNLTVIDK Gamma sulfur oxidizers_DNA polymerase III;alpha subunit Genetic Information Processing;Replication and Repair;DNA replication 194 45.934 -130.0138 1450 gi|269469110|gb|EEZ80658.1| 0.9964 2 4 GVGEALVQTLVAER Gamma sulfur oxidizers_DNA polymerase III;alpha subunit Genetic Information Processing;Replication and Repair;DNA replication 202 45.934 -130.0138 1450 gi|118602238|ref|YP_903453.1| 0.995 1 4 AEQIYYIGDLIQK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit alpha Genetic Information Processing;Transcription;RNA polymerase 202 45.934 -130.0138 1450 gi|148244354|ref|YP_001219048.1| 0.995 1 4 AEQIYYIGDLIQK Gamma sulfur oxidizers_DNA-directed RNA polymerase subunit alpha Genetic Information Processing;Transcription;RNA polymerase 208 45.934 -130.0138 1450 gi|118602495|ref|YP_903710.1| 0.995 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism;Lipid metabolism;Fatty acid biosynthesis 208 45.934 -130.0138 1450 gi|148244595|ref|YP_001219289.1| 0.995 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism;Lipid metabolism;Fatty acid biosynthesis 208 45.934 -130.0138 1450 gi|269467947|gb|EEZ79682.1| 0.995 1 4 VLVVGSETLSR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism;Lipid metabolism;Fatty acid biosynthesis 216 45.934 -130.0138 1450 gi|148244330|ref|YP_001219024.1| 0.995 1 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing;Translation;Ribosome 216 45.934 -130.0138 1450 gi|269468076|gb|EEZ79790.1| 0.995 1 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing;Translation;Ribosome 216 45.934 -130.0138 1450 gi|356960855|ref|ZP_09063837.1| 0.995 1 4 DALLMTDELDENLYLSSR Gamma sulfur oxidizers_50S ribosomal protein L4 Genetic Information Processing;Translation;Ribosome 223 45.934 -130.0138 1450 gi|260072624|gb|ACX30522.1| 0.995 1 4 ALLESIADNIAIALDK Gamma sulfur oxidizers_signal transduction histidine kinase nitrate/nitrite-specific Environmental Information Processing;Signal transduction;Two-component system 223 45.934 -130.0138 1450 gi|269468661|gb|EEZ80301.1| 0.995 1 4 ALLESIADNIAIALDK Gamma sulfur oxidizers_signal transduction histidine kinase nitrate/nitrite-specific Environmental Information Processing;Signal transduction;Two-component system 235 45.934 -130.0138 1450 gi|269468524|gb|EEZ80178.1| 0.995 1 4 VNYINQIASR Gamma sulfur oxidizers_hypothetical protein Sup05_0460 Unassigned 245 45.934 -130.0138 1450 gi|357405116|ref|YP_004917040.1| 0.995 1 4 WVLAGTDYVYPR Methylotrophs_unnamed protein product Environmental Information Processing;Membrane transport;ABC transporters 251 45.934 -130.0138 1450 gi|148244986|ref|YP_001219680.1| 0.9944 2 4 INVATYQAVSGSGK Gamma sulfur oxidizers_aspartate-semialdehyde dehydrogenase Metabolism;Amino acid metabolism; 251 45.934 -130.0138 1450 gi|148244986|ref|YP_001219680.1| 0.9944 2 4 IFEDENILVNPTAVR Gamma sulfur oxidizers_aspartate-semialdehyde dehydrogenase Metabolism;Amino acid metabolism; 252 45.934 -130.0138 1450 gi|344259778|gb|EGW20050.1| 0.9943 2 4 GFPVAYVGDVVGTGSSR Methylotrophs_aconitate hydratase 2 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) 252 45.934 -130.0138 1450 gi|344259778|gb|EGW20050.1| 0.9943 2 4 VEQAFELSDASAER Methylotrophs_aconitate hydratase 2 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) 252 45.934 -130.0138 1450 gi|357406352|ref|YP_004918276.1| 0.9943 2 4 GFPVAYVGDVVGTGSSR Methylotrophs_aconitate hydratase 2 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) 252 45.934 -130.0138 1450 gi|357406352|ref|YP_004918276.1| 0.9943 2 4 VEQAFELSDASAER Methylotrophs_aconitate hydratase 2 Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) 255 45.934 -130.0138 1450 gi|148244791|ref|YP_001219485.1| 0.9931 2 4 EEDGIVLIDQDK Bacteria_respiratory nitrate reductase beta subunit Metabolism;Energy Metabolism;Nitrogen metabolism 255 45.934 -130.0138 1450 gi|148244791|ref|YP_001219485.1| 0.9931 2 4 REEDGIVLIDQDK Bacteria_respiratory nitrate reductase beta subunit Metabolism;Energy Metabolism;Nitrogen metabolism 255 45.934 -130.0138 1450 gi|344260553|gb|EGW20825.1| 0.9931 2 4 EEDGIVLIDQDK Bacteria_respiratory nitrate reductase beta subunit Metabolism;Energy Metabolism;Nitrogen metabolism 255 45.934 -130.0138 1450 gi|344260553|gb|EGW20825.1| 0.9931 2 4 REEDGIVLIDQDK Bacteria_respiratory nitrate reductase beta subunit Metabolism;Energy Metabolism;Nitrogen metabolism 274 45.934 -130.0138 1450 gi|269467764|gb|EEZ79528.1| 0.9709 1 4 GLINDPDLDESFNIDK Gamma sulfur oxidizers_3-deoxy-D-arabino-heptulosonate 7-phosphate (DAHP) synthase Metabolism;Amino acid metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis 280 45.934 -130.0138 1450 gi|118602983|ref|YP_904198.1| 0.9613 1 4 VSDVSAVDIGIVSPDGR Gamma sulfur oxidizers_ribokinase-like domain-containing protein Metabolism;Nucleotide metabolism;Purine metabolism 283 45.934 -130.0138 1450 gi|260072675|gb|ACX30572.1| 0.959 1 4 FGETEIQPLSR Gamma sulfur oxidizers_pyruvate dehydrogenase complex E2 component Metabolism;Carbohydrate metabolism;Citrate cycle (TCA cycle) 300 45.934 -130.0138 1450 gi|269468357|gb|EEZ80028.1| 0.9331 1 4 QSGLTEEQVSNPR Gamma sulfur oxidizers_3-oxoacyl-(acyl-carrier-protein) synthase Metabolism;Lipid metabolism;Fatty acid biosynthesis 307 45.934 -130.0138 1450 gi|291613825|ref|YP_003523982.1| 0.9237 1 4 FHWAVADYLQR Iron oxidizers_phosphofructokinase Metabolism;Carbohydrate metabolism;Glycolysis/Gluconeogenesis 314 45.934 -130.0138 1450 gi|118602286|ref|YP_903501.1| 0.9078 1 4 TSYVLESLYGFDR Gamma sulfur oxidizers_proton-translocating NADH-quinone oxidoreductase;chain L Metabolism;Energy metabolism;Oxidative phosphorylation 315 45.934 -130.0138 1450 gi|344259827|gb|EGW20099.1| 0.907 1 4 AVAAGMNPMDLK Methylotrophs_60 kDa chaperonin Genetic Information Processing;Folding;sorting and degradation;RNA degradation 315 45.934 -130.0138 1450 gi|357404657|ref|YP_004916581.1| 0.907 1 4 AVAAGMNPMDLK Methylotrophs_60 kDa chaperonin Genetic Information Processing;Folding;sorting and degradation;RNA degradation 316 45.934 -130.0138 1450 gi|269468131|gb|EEZ79838.1| 0.9052 1 4 LFTELGPFYK Gamma sulfur oxidizers_ribosomal protein L17 Genetic Information Processing;Translation;Ribosome 316 45.934 -130.0138 1450 gi|269469226|gb|EEZ80757.1| 0.9052 1 4 LFTELGPFYK Gamma sulfur oxidizers_ribosomal protein L17 Genetic Information Processing;Translation;Ribosome 147a 45.934 -130.0138 1450 gi|269469209|gb|EEZ80743.1| 0.9994 3 4 DVSGEGVQQAMLK Gamma sulfur oxidizers_ATP-dependent protease Clp;ATPase subunit Unassigned 147a 45.934 -130.0138 1450 gi|269469209|gb|EEZ80743.1| 0.9994 3 4 TLLAQTLAR Gamma sulfur oxidizers_ATP-dependent protease Clp;ATPase subunit Unassigned 147a 45.934 -130.0138 1450 gi|269469209|gb|EEZ80743.1| 0.9994 3 4 LQSGYISNDVELDK Gamma sulfur oxidizers_ATP-dependent protease Clp;ATPase subunit Unassigned 164a 45.934 -130.0138 1450 gi|269467765|gb|EEZ79529.1| 0.9971 2 4 AYDNPAFVEDLVR Gamma sulfur oxidizers_hypothetical protein Sup05_0756 Unassigned 164a 45.934 -130.0138 1450 gi|269467765|gb|EEZ79529.1| 0.9971 2 4 FTMTVSLPEHVK Gamma sulfur oxidizers_hypothetical protein Sup05_0756 Unassigned 165a 45.934 -130.0138 1450 gi|269468785|gb|EEZ80389.1| 0.9995 2 4 LNEDGPASPILK Gamma sulfur oxidizers_aspartyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 165a 45.934 -130.0138 1450 gi|269468785|gb|EEZ80389.1| 0.9995 2 4 DHGGVIFLDMR Gamma sulfur oxidizers_aspartyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 167a 45.934 -130.0138 1450 gi|118602382|ref|YP_903597.1| 0.9987 2 4 MLLNIIDLEK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 unassigned 167a 45.934 -130.0138 1450 gi|118602382|ref|YP_903597.1| 0.9987 2 4 MVVNDAKPIIASNYQK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 unassigned 167a 45.934 -130.0138 1450 gi|269467802|gb|EEZ79557.1| 0.9987 2 4 MLLNIIDLEK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 unassigned 167a 45.934 -130.0138 1450 gi|269467802|gb|EEZ79557.1| 0.9987 2 4 MVVNDAKPIIASNYQK Gamma sulfur oxidizers_hypothetical protein Rmag_0350 unassigned 184a 45.934 -130.0138 1450 gi|260072613|gb|ACX30512.1| 0.9971 2 4 WVDGPLTLAAR Gamma sulfur oxidizers_rubisco regulator CbbQ Unassigned 184a 45.934 -130.0138 1450 gi|260072613|gb|ACX30512.1| 0.9971 2 4 AHPDFQLVISYNPGYQSLMK Gamma sulfur oxidizers_rubisco regulator CbbQ Unassigned 189a 45.934 -130.0138 1450 gi|269468539|gb|EEZ80193.1| 0.9971 2 4 IIVDTYGGMAR Gamma sulfur oxidizers_S-adenosylmethionine synthetase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 189a 45.934 -130.0138 1450 gi|269468539|gb|EEZ80193.1| 0.9971 2 4 GLIAMLDLK Gamma sulfur oxidizers_S-adenosylmethionine synthetase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 256a 45.934 -130.0138 1450 gi|118602623|ref|YP_903838.1| 0.9927 2 4 NDELPVLEIVK Gamma sulfur oxidizers_ArsR family transcriptional regulator Unassigned 256a 45.934 -130.0138 1450 gi|118602623|ref|YP_903838.1| 0.9927 2 4 KVGSSQSNISQHIDILR Gamma sulfur oxidizers_ArsR family transcriptional regulator Unassigned 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 IIQELEGMFR Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 MEEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 QLGIYSASGQLYQPEDSDK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 VGDLAWAAGDMQAK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 LGLEQVEIFAK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 RFDVPVTDTDVK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 M[147]EEVVDGEYQAYK Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 TFGMEGLFR Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 54b 45.934 -130.0138 1450 gi|269467865|gb|EEZ79608.1| 0.9966 9 4 EMSTTMALNR Gamma sulfur oxidizers_pyruvate dehydrogenase complex;dehydrogenase (E1) component Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) glycolysis;and pyruvate metabolism or Amino Acid Metabolism;Valine;leucine and isoleucine biosynthesis 55a 45.934 -130.0138 1450 gi|118602533|ref|YP_903748.1| 0.9932 3 4 TLGIGVTNLAYYLAK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha Metabolism;Nucleotide Metabolism;Purine and pyrimidine metabolism 55a 45.934 -130.0138 1450 gi|118602533|ref|YP_903748.1| 0.9932 3 4 TFEALQYYSLK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha Metabolism;Nucleotide Metabolism;Purine and pyrimidine metabolism 55a 45.934 -130.0138 1450 gi|118602533|ref|YP_903748.1| 0.9932 3 4 TEDIHETIIK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha Metabolism;Nucleotide Metabolism;Purine and pyrimidine metabolism 64a 45.934 -130.0138 1450 gi|118602985|ref|YP_904200.1| 1 2 4 FMGGSMGSVVGEK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|118602985|ref|YP_904200.1| 1 2 4 MQEGLFSLMQMSK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|148245055|ref|YP_001219749.1| 1 2 4 FMGGSMGSVVGEK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|148245055|ref|YP_001219749.1| 1 2 4 MQEGLFSLMQMSK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|260072642|gb|ACX30540.1| 1 2 4 FMGGSMGSVVGEK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|260072642|gb|ACX30540.1| 1 2 4 MQEGLFSLMQMSK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|269468642|gb|EEZ80282.1| 1 2 4 FMGGSMGSVVGEK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 64a 45.934 -130.0138 1450 gi|269468642|gb|EEZ80282.1| 1 2 4 MQEGLFSLMQMSK Gamma sulfur oxidizers_acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha Metabolism;Lipid;carbohydrate;or Terpenoids and Polyketides 65a 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9991 5 4 DRGEDALIVYDDLTK Gamma sulfur oxidizers_ATP synthase F1;alpha subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 65a 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9991 5 4 EAYPGDVFYLHSR Gamma sulfur oxidizers_ATP synthase F1;alpha subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 65a 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9991 5 4 GEDALIVYDDLTK Gamma sulfur oxidizers_ATP synthase F1;alpha subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 65a 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9991 5 4 AIDAMVPVGR Gamma sulfur oxidizers_ATP synthase F1;alpha subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 65a 45.934 -130.0138 1450 gi|118603007|ref|YP_904222.1| 0.9991 5 4 AIDAM[147]VPVGR Gamma sulfur oxidizers_ATP synthase F1;alpha subunit Metabolism;Energy Metabolism;Oxidative phosphorylation 67b 45.934 -130.0138 1450 gi|269468175|gb|EEZ79874.1| 0.9999 2 4 INFSHGSEEEHLGR Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 67b 45.934 -130.0138 1450 gi|269468175|gb|EEZ79874.1| 0.9999 2 4 GGGLSANALTEK Gamma sulfur oxidizers_pyruvate kinase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms or Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;or pyruvate metabolism or Nucleotide Metabolism;Purine metabolism 24 45.934 -130.0138 1450 gi|269468355|gb|EEZ80026.1| 1 2 3 LFLLETPSNPLGEVVDITALSK Gamma sulfur oxidizers_cystathionine beta-lyases/cystathionine gamma-synthase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 24 45.934 -130.0138 1450 gi|269468355|gb|EEZ80026.1| 1 2 3 ATGPSLSAFNAWIVLK Gamma sulfur oxidizers_cystathionine beta-lyases/cystathionine gamma-synthase Metabolism;Amino Acid Metabolism;Cysteine and methionine metabolism 151 45.934 -130.0138 1450 gi|344262230|gb|EGW22501.1| 0.9998 2 3 VYM[147]QPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 151 45.934 -130.0138 1450 gi|291613253|ref|YP_003523410.1| 0.9998 2 3 VYMQPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 151 45.934 -130.0138 1450 gi|291613253|ref|YP_003523410.1| 0.9998 2 3 VYM[147]QPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 151 45.934 -130.0138 1450 gi|344262230|gb|EGW22501.1| 0.9998 2 3 VYMQPASEGTGIIAGGAMR Bacteria_30S ribosomal protein S5 Genetic Information Processing;Translation;Ribosome 169 45.934 -130.0138 1450 gi|118602599|ref|YP_903814.1| 0.9991 2 3 SEGFISLDEFK Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 169 45.934 -130.0138 1450 gi|118602599|ref|YP_903814.1| 0.9991 2 3 QLTASPWDNISDR Gamma sulfur oxidizers_30S ribosomal protein S1 Genetic Information Processing;Translation;Ribosome 170 45.934 -130.0138 1450 gi|269468339|gb|EEZ80013.1| 0.9991 3 3 SFDQPLNVFEVAK Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 170 45.934 -130.0138 1450 gi|269468339|gb|EEZ80013.1| 0.9991 3 3 GWTLYQIVEQYMR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 170 45.934 -130.0138 1450 gi|269468339|gb|EEZ80013.1| 0.9991 3 3 FGDAMFTTSSENR Gamma sulfur oxidizers_threonyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 173 45.934 -130.0138 1450 gi|344262249|gb|EGW22520.1| 0.9991 2 3 VMAELQGGEVK Methylotrophs_translation elongation factor Tu Unassigned (translation factors) 173 45.934 -130.0138 1450 gi|344262249|gb|EGW22520.1| 0.9991 2 3 LLDQGQAGDNVGILLR Methylotrophs_translation elongation factor Tu Unassigned (translation factors) 173 45.934 -130.0138 1450 gi|344262262|gb|EGW22533.1| 0.9991 2 3 VMAELQGGEVK Methylotrophs_translation elongation factor Tu Unassigned (translation factors) 173 45.934 -130.0138 1450 gi|344262262|gb|EGW22533.1| 0.9991 2 3 LLDQGQAGDNVGILLR Methylotrophs_translation elongation factor Tu Unassigned (translation factors) 204 45.934 -130.0138 1450 gi|118602287|ref|YP_903502.1| 0.995 1 3 EISTYGGVINSMPK Gamma sulfur oxidizers_proton-translocating NADH-quinone oxidoreductase;chain M Metabolism;Energy metabolism;Oxidative phosphorylation 204 45.934 -130.0138 1450 gi|269468287|gb|EEZ79969.1| 0.995 1 3 EISTYGGVINSMPK Gamma sulfur oxidizers_proton-translocating NADH-quinone oxidoreductase;chain M Metabolism;Energy metabolism;Oxidative phosphorylation 209 45.934 -130.0138 1450 gi|118602677|ref|YP_903892.1| 0.995 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 209 45.934 -130.0138 1450 gi|260072563|gb|ACX30463.1| 0.995 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 209 45.934 -130.0138 1450 gi|269468003|gb|EEZ79731.1| 0.995 1 3 GYGFITGDDGEK Gamma sulfur oxidizers_cold-shock DNA-binding domain-containing protein Unassigned 220 45.934 -130.0138 1450 gi|148244867|ref|YP_001219561.1| 0.995 1 3 NPPILIFDEATSALDSYSEK Gamma sulfur oxidizers_ABC transporter ATP-binding protein Unassigned 221 45.934 -130.0138 1450 gi|148245106|ref|YP_001219800.1| 0.995 1 3 VLVINSLDDLK Gamma sulfur oxidizers_hypothetical protein COSY_0978 Unassigned 222 45.934 -130.0138 1450 gi|161529010|ref|YP_001582836.1| 0.995 1 3 LVELGAETPGENPYVAEMYK Chrenarchaeota_ammonia monooxygenase/methane monooxygenase subunit C Metabolism;Energy metabolism;Nitrogen metabolism 227 45.934 -130.0138 1450 gi|269467816|gb|EEZ79568.1| 0.995 1 3 SQGAFYSFPR Gamma sulfur oxidizers_Aspartate/tyrosine/aromatic aminotransferase Metabolism;Amino acid metabolism; 230 45.934 -130.0138 1450 gi|269467886|gb|EEZ79625.1| 0.995 1 3 DNVNVFYAPGAFEIPLLAK Gamma sulfur oxidizers_riboflavin synthase beta-chain Metabolism;Metabolism of cofactors and vitamins;Riboflavin metabolism 233 45.934 -130.0138 1450 gi|269468189|gb|EEZ79885.1| 0.995 1 3 ALDDMSVANLFFEPSTR Gamma sulfur oxidizers_aspartate carbamoyltransferase Metabolism;Nucleotide metabolism;Pyrimidine metabolism 236 45.934 -130.0138 1450 gi|269468626|gb|EEZ80270.1| 0.995 1 3 LHLLESGLDVDYQK Gamma sulfur oxidizers_2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1_4-benzoquinol methylase Metabolism;Metabolism of cofactors and vitamins;Ubiquinone and other terpenoid-quinone biosynthesis 238 45.934 -130.0138 1450 gi|269468770|gb|EEZ80379.1| 0.995 1 3 DTTLIDNTPIDYLDFASPVSGLGSK Gamma sulfur oxidizers_3-polyprenyl-4-hydroxybenzoate decarboxylase Metabolism;Metabolism of cofactors and vitamins;Ubiquinone and other terpenoid-quinone biosynthesis 239 45.934 -130.0138 1450 gi|269468788|gb|EEZ80392.1| 0.995 1 3 SGEQSEDLDFASVQR Gamma sulfur oxidizers_phosphoribosylformylglycinamidine (FGAM) synthase Metabolism;Nucleotide metabolism;Purine metabolism 246 45.934 -130.0138 1450 gi|357406659|ref|YP_004918583.1| 0.995 1 3 AIAAGITEVAFDR Methylotrophs_rplR gene product Genetic Information Processing;Translation;Ribosome 254 45.934 -130.0138 1450 gi|260072695|gb|ACX30592.1| 0.994 2 3 SYVMGQYSANQLGLK Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 254 45.934 -130.0138 1450 gi|260072695|gb|ACX30592.1| 0.994 2 3 GLVVTELMGQGINGTTGDYSR Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 254 45.934 -130.0138 1450 gi|269468469|gb|EEZ80130.1| 0.994 2 3 SYVMGQYSANQLGLK Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 254 45.934 -130.0138 1450 gi|269468469|gb|EEZ80130.1| 0.994 2 3 GLVVTELMGQGINGTTGDYSR Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 260 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9901 5 3 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 260 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9901 5 3 ESTFCCGGGGGLLTDDLMEIR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 260 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9901 5 3 AALDLEVSR Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 260 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9901 5 3 AVCNNYVDMER Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 260 45.934 -130.0138 1450 gi|148244924|ref|YP_001219618.1| 0.9901 5 3 EGVMDGEGPFK Gamma sulfur oxidizers_intracellular sulfur oxidation protein DsrK Unassigned 263 45.934 -130.0138 1450 gi|269468606|gb|EEZ80250.1| 0.9889 2 3 IASSDAVMWR Gamma sulfur oxidizers_prephenate dehydrogenase Metabolism;Amino Acid Metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis or biosynthesis of other secondary metabolites;novobiocin biosyntheis 263 45.934 -130.0138 1450 gi|269468606|gb|EEZ80250.1| 0.9889 2 3 VILTPEDNADTDAIEQVTK Gamma sulfur oxidizers_prephenate dehydrogenase Metabolism;Amino Acid Metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis or biosynthesis of other secondary metabolites;novobiocin biosyntheis 267 45.934 -130.0138 1450 gi|269468071|gb|EEZ79785.1| 0.983 2 3 LAQQIVLIDLDEQYAK Gamma sulfur oxidizers_Malate/lactate dehydrogenase Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) or Pyruvate metabolism or Glyoxylate and dicarboxylate metabolism or Energy Metabolism;Carbon fixation in photosynthetic organisms 267 45.934 -130.0138 1450 gi|269468071|gb|EEZ79785.1| 0.983 2 3 IMGQAGILDSMR Gamma sulfur oxidizers_Malate/lactate dehydrogenase Metabolism;Carbohydrate Metabolism;Citrate cycle (TCA cycle) or Pyruvate metabolism or Glyoxylate and dicarboxylate metabolism or Energy Metabolism;Carbon fixation in photosynthetic organisms 269 45.934 -130.0138 1450 gi|118602111|ref|YP_903326.1| 0.9801 1 3 ELFLMVEAISNEK Gamma sulfur oxidizers_NusA antitermination factor Unassigned 269 45.934 -130.0138 1450 gi|148244225|ref|YP_001218919.1| 0.9801 1 3 ELFLMVEAISNEK Gamma sulfur oxidizers_NusA antitermination factor Unassigned 294 45.934 -130.0138 1450 gi|118602389|ref|YP_903604.1| 0.9474 2 3 NPLTPILLSAQR Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 294 45.934 -130.0138 1450 gi|118602389|ref|YP_903604.1| 0.9474 2 3 VFEPYVTTK Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 294 45.934 -130.0138 1450 gi|148244497|ref|YP_001219191.1| 0.9474 2 3 NPLTPILLSAQR Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 294 45.934 -130.0138 1450 gi|148244497|ref|YP_001219191.1| 0.9474 2 3 VFEPYVTTK Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 294 45.934 -130.0138 1450 gi|269468829|gb|EEZ80433.1| 0.9474 2 3 NPLTPILLSAQR Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 294 45.934 -130.0138 1450 gi|269468829|gb|EEZ80433.1| 0.9474 2 3 VFEPYVTTK Gamma sulfur oxidizers_periplasmic sensor signal transduction histidine kinase Unassigned 299 45.934 -130.0138 1450 gi|269468566|gb|EEZ80215.1| 0.9404 1 3 GAGGFAGELLFHPFGK Gamma sulfur oxidizers_F0F1-type ATP synthase;subunit a Metabolism;Energy metabolism;Oxidative phosphorylation 301 45.934 -130.0138 1450 gi|118603031|ref|YP_904246.1| 0.9322 1 3 LGEEVDNVLR Gamma sulfur oxidizers_ribulose-5-phosphate 3-epimerase Metabolism;Carbohydrate metabolism;Pentose phosphate pathway 301 45.934 -130.0138 1450 gi|269469078|gb|EEZ80633.1| 0.9322 1 3 LGEEVDNVLR Gamma sulfur oxidizers_ribulose-5-phosphate 3-epimerase Metabolism;Carbohydrate metabolism;Pentose phosphate pathway 308 45.934 -130.0138 1450 gi|269468286|gb|EEZ79968.1| 0.9175 1 3 FNEIVFVNGVK Gamma sulfur oxidizers_NADH:ubiquinone oxidoreductase;chain L Metabolism;Energy metabolism;Oxidative phosphorylation 131b 45.934 -130.0138 1450 gi|118602186|ref|YP_903401.1| 0.9506 3 3 ALGVTMFLPEK Gamma sulfur oxidizers_ATP-dependent metalloprotease FtsH Unassigned 131b 45.934 -130.0138 1450 gi|118602186|ref|YP_903401.1| 0.9506 3 3 DESDTTFDDVAGVDEAK Gamma sulfur oxidizers_ATP-dependent metalloprotease FtsH Unassigned 131b 45.934 -130.0138 1450 gi|118602186|ref|YP_903401.1| 0.9506 3 3 NAPCIIFIDEIDAVGR Gamma sulfur oxidizers_ATP-dependent metalloprotease FtsH Unassigned 132a 45.934 -130.0138 1450 gi|357404841|ref|YP_004916765.1| 1 2 3 MYGVEAAGDGVETGR Methylotrophs_trpB gene product Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism;or Phenylalanine;tyrosine and tryptophan biosynthesis 132a 45.934 -130.0138 1450 gi|357404841|ref|YP_004916765.1| 1 2 3 IIAETGAGQHGVATATVAAR Methylotrophs_trpB gene product Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism;or Phenylalanine;tyrosine and tryptophan biosynthesis 143a 45.934 -130.0138 1450 gi|148245048|ref|YP_001219742.1| 0.9997 3 3 TQVGIIVETGEAR Gamma sulfur oxidizers_glutamate synthase (NADPH) large chain Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or Energy metabolism;nitrogen metabolism 143a 45.934 -130.0138 1450 gi|148245048|ref|YP_001219742.1| 0.9997 3 3 TIDITYDINK Gamma sulfur oxidizers_glutamate synthase (NADPH) large chain Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or Energy metabolism;nitrogen metabolism 143a 45.934 -130.0138 1450 gi|148245048|ref|YP_001219742.1| 0.9997 3 3 QLFAQVTNPAIDSIR Gamma sulfur oxidizers_glutamate synthase (NADPH) large chain Metabolism;Amino Acid Metabolism;Alanine;aspartate and glutamate metabolism or Energy metabolism;nitrogen metabolism 153a 45.934 -130.0138 1450 gi|269467867|gb|EEZ79610.1| 0.9997 2 3 LIGLAIGSESIAK Gamma sulfur oxidizers_phosphomannomutase Metabolism;Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;Pentose phosphate pathway;Fructose and mannose metabolism or Galactose metabolism or Starch and sucrose metabolism or Amino sugar and nucleotide sugar metabolism or Nucleotide Metabolism;Purine metabolism or Biosynthesis of Other Secondary Metabolites;Streptomycin biosynthesis 153a 45.934 -130.0138 1450 gi|269467867|gb|EEZ79610.1| 0.9997 2 3 IMIAGETLSGDR Gamma sulfur oxidizers_phosphomannomutase Metabolism;Carbohydrate Metabolism;Glycolysis/Gluconeogenesis;Pentose phosphate pathway;Fructose and mannose metabolism or Galactose metabolism or Starch and sucrose metabolism or Amino sugar and nucleotide sugar metabolism or Nucleotide Metabolism;Purine metabolism or Biosynthesis of Other Secondary Metabolites;Streptomycin biosynthesis 177a 45.934 -130.0138 1450 gi|260072644|gb|ACX30542.1| 0.9989 3 3 APLIGFSGSPWTLATYMIEGGSSK Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 177a 45.934 -130.0138 1450 gi|260072644|gb|ACX30542.1| 0.9989 3 3 HPNTPITLFSK Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 177a 45.934 -130.0138 1450 gi|260072644|gb|ACX30542.1| 0.9989 3 3 TPIWVMR Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 177a 45.934 -130.0138 1450 gi|269468640|gb|EEZ80280.1| 0.9989 3 3 APLIGFSGSPWTLATYMIEGGSSK Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 177a 45.934 -130.0138 1450 gi|269468640|gb|EEZ80280.1| 0.9989 3 3 HPNTPITLFSK Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 177a 45.934 -130.0138 1450 gi|269468640|gb|EEZ80280.1| 0.9989 3 3 TPIWVMR Gamma sulfur oxidizers_uroporphyrinogen-III decarboxylase Metabolism;Metabolism of Cofactors and Vitamins;Porphyrin and chlorophyll metabolism 178a 45.934 -130.0138 1450 gi|291612475|ref|YP_003522632.1| 0.9739 2 3 DPALSELYLVEGDSAGGSAK Iron oxidizers_DNA gyrase;B subunit Unassigned 178a 45.934 -130.0138 1450 gi|291612475|ref|YP_003522632.1| 0.9739 2 3 TLLLTFFYR Iron oxidizers_DNA gyrase;B subunit Unassigned 178a 45.934 -130.0138 1450 gi|302877248|ref|YP_003845812.1| 0.9739 2 3 DPALSELYLVEGDSAGGSAK Iron oxidizers_DNA gyrase;B subunit Unassigned 178a 45.934 -130.0138 1450 gi|302877248|ref|YP_003845812.1| 0.9739 2 3 TLLLTFFYR Iron oxidizers_DNA gyrase;B subunit Unassigned 185a 45.934 -130.0138 1450 gi|269467870|gb|EEZ79613.1| 0.9982 2 3 NLISAPVIDENNQLIGR Gamma sulfur oxidizers_Mg/Co/Ni transporter MgtE Unassigned 185a 45.934 -130.0138 1450 gi|269467870|gb|EEZ79613.1| 0.9982 2 3 ITIDDVVDVIR Gamma sulfur oxidizers_Mg/Co/Ni transporter MgtE Unassigned 187a 45.934 -130.0138 1450 gi|269469031|gb|EEZ80595.1| 0.9979 2 3 IVDVAESVINAFELLE Gamma sulfur oxidizers_hypothetical protein Sup05_0253 Unassigned 187a 45.934 -130.0138 1450 gi|269469031|gb|EEZ80595.1| 0.9979 2 3 SGVNAYIVDGLEENR Gamma sulfur oxidizers_hypothetical protein Sup05_0253 Unassigned 190a 45.934 -130.0138 1450 gi|269468360|gb|EEZ80031.1| 0.9851 2 3 TLYLIPTGEVPITNMVR Gamma sulfur oxidizers_seryl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 190a 45.934 -130.0138 1450 gi|269468360|gb|EEZ80031.1| 0.9851 2 3 VELVQVVK Gamma sulfur oxidizers_seryl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 259a 45.934 -130.0138 1450 gi|269468356|gb|EEZ80027.1| 0.9903 2 3 M[147]QNSFSYEELIK Gamma sulfur oxidizers_3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase Metabolism;Lipid Metabolism;Fatty acid biosynthesis 259a 45.934 -130.0138 1450 gi|269468356|gb|EEZ80027.1| 0.9903 2 3 FTGQVLPTAK Gamma sulfur oxidizers_3-hydroxymyristoyl/3-hydroxydecanoyl-(acyl carrier protein) dehydratase Metabolism;Lipid Metabolism;Fatty acid biosynthesis 264a 45.934 -130.0138 1450 gi|269469059|gb|EEZ80617.1| 0.988 2 3 SDGVFVMDGSK Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 264a 45.934 -130.0138 1450 gi|269469059|gb|EEZ80617.1| 0.988 2 3 SSHGNAYFTGIGK Gamma sulfur oxidizers_Zn-dependent protease Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 281a 45.934 -130.0138 1450 gi|269468784|gb|EEZ80388.1| 0.9595 2 3 ALLVEYPR Gamma sulfur oxidizers_hypothetical protein Sup05_0824 Unassigned 281a 45.934 -130.0138 1450 gi|269468784|gb|EEZ80388.1| 0.9595 2 3 KLSDTVLSPSGESFK Gamma sulfur oxidizers_hypothetical protein Sup05_0824 Unassigned 298a 45.934 -130.0138 1450 gi|269467837|gb|EEZ79583.1| 0.9421 2 3 LIFALDVPEVDQAK Gamma sulfur oxidizers_orotidine-5'-phosphate decarboxylase Metabolism;Nucleotide Metabolism;Pyrimidine metabolism 298a 45.934 -130.0138 1450 gi|269467837|gb|EEZ79583.1| 0.9421 2 3 VVDVATAFK Gamma sulfur oxidizers_orotidine-5'-phosphate decarboxylase Metabolism;Nucleotide Metabolism;Pyrimidine metabolism 309a 45.934 -130.0138 1450 gi|344262255|gb|EGW22526.1| 0.9148 2 3 VSALGPGGLAR Methylotrophs_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 309a 45.934 -130.0138 1450 gi|344262255|gb|EGW22526.1| 0.9148 2 3 ITMGDDLAPGVLK Methylotrophs_DNA-directed RNA polymerase subunit beta Genetic Information Processing;Transcription;RNA polymerase 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 DQGVDLTNDPMALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 QAVTNPENTLYAIK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 DQGVDLTNDPM[147]ALQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 HFEVLSTNGDTFLGGEDFDQR Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 IINEPTAAALAYGVDK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 51b 45.934 -130.0138 1450 gi|148244501|ref|YP_001219195.1| 0.9715 6 3 IELSSSEQTEVNLPYVTADASGPK Gamma sulfur oxidizers_molecular chaperone DnaK Genetic Information Processing;Folding;Sorting and Degradation;RNA degradation 53b 45.934 -130.0138 1450 gi|269468886|gb|EEZ80478.1| 0.9947 3 3 AGNTSLEELVMAVR Gamma sulfur oxidizers_isopropylmalate/homocitrate/citramalate synthase Metabolism;Carbohydrate metabolism;Pyruvate metabolism 53b 45.934 -130.0138 1450 gi|269468886|gb|EEZ80478.1| 0.9947 3 3 IINGQGADTDIITASAK Gamma sulfur oxidizers_isopropylmalate/homocitrate/citramalate synthase Metabolism;Carbohydrate metabolism;Pyruvate metabolism 53b 45.934 -130.0138 1450 gi|269468886|gb|EEZ80478.1| 0.9947 3 3 LVSSVTGFIVQPNK Gamma sulfur oxidizers_isopropylmalate/homocitrate/citramalate synthase Metabolism;Carbohydrate metabolism;Pyruvate metabolism 55b 45.934 -130.0138 1450 gi|356960838|ref|ZP_09063820.1| 0.9886 2 3 TLGIGVTNLAYYLAK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha;partial Metabolism;Nucleotide metabolism; 55b 45.934 -130.0138 1450 gi|356960838|ref|ZP_09063820.1| 0.9886 2 3 SLDSLLDYQDYPLK Gamma sulfur oxidizers_ribonucleotide-diphosphate reductase subunit alpha;partial Metabolism;Nucleotide metabolism; 76b 45.934 -130.0138 1450 gi|269468408|gb|EEZ80073.1| 0.9564 2 3 SFVLDEADEMLK Gamma sulfur oxidizers_hypothetical protein Sup05_1317 Genetic Information Processing;Folding;sorting and degradation;RNA degradation 76b 45.934 -130.0138 1450 gi|269468408|gb|EEZ80073.1| 0.9564 2 3 FSDFGLSDSILK Gamma sulfur oxidizers_hypothetical protein Sup05_1317 Genetic Information Processing;Folding;sorting and degradation;RNA degradation 168 45.934 -130.0138 1450 gi|269468892|gb|EEZ80482.1| 0.9993 2 2 DVLLEHGANGLFELLDLGIAK Gamma sulfur oxidizers_ATP phosphoribosyltransferase Metabolism;Amino Acid Metabolism;Histidine metabolism 168 45.934 -130.0138 1450 gi|269468892|gb|EEZ80482.1| 0.9993 2 2 LILDTNLDDVK Gamma sulfur oxidizers_ATP phosphoribosyltransferase Metabolism;Amino Acid Metabolism;Histidine metabolism 180 45.934 -130.0138 1450 gi|269468618|gb|EEZ80262.1| 0.9988 2 2 TTFMDFSEDLEEATDENK Gamma sulfur oxidizers_thioredoxin SoxW Unassigned 180 45.934 -130.0138 1450 gi|269468618|gb|EEZ80262.1| 0.9988 2 2 DFDVIETNMWGDR Gamma sulfur oxidizers_thioredoxin SoxW Unassigned 182 45.934 -130.0138 1450 gi|118602625|ref|YP_903840.1| 0.9987 2 2 DYFVHEATNLLK Gamma sulfur oxidizers_carboxyl-terminal protease Unassigned 182 45.934 -130.0138 1450 gi|118602625|ref|YP_903840.1| 0.9987 2 2 AIIMGSTSFGK Gamma sulfur oxidizers_carboxyl-terminal protease Unassigned 199 45.934 -130.0138 1450 gi|118602065|ref|YP_903280.1| 0.995 1 2 NAIVNWDPVDQTVLANEQVIDGR Gamma sulfur oxidizers_leucyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 201 45.934 -130.0138 1450 gi|118602222|ref|YP_903437.1| 0.995 1 2 HWALLEVVEK Gamma sulfur oxidizers_30S ribosomal protein S17 Genetic Information Processing;Translation;Ribosome 201 45.934 -130.0138 1450 gi|269468083|gb|EEZ79797.1| 0.995 1 2 HWALLEVVEK Gamma sulfur oxidizers_30S ribosomal protein S17 Genetic Information Processing;Translation;Ribosome 203 45.934 -130.0138 1450 gi|269468275|gb|EEZ79959.1| 0.995 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism;Nucleotide metabolism;Pyrimidine metabolism 203 45.934 -130.0138 1450 gi|118602262|ref|YP_903477.1| 0.995 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism;Nucleotide metabolism;Pyrimidine metabolism 203 45.934 -130.0138 1450 gi|148244374|ref|YP_001219068.1| 0.995 1 2 FTDASYAYQGGGR Gamma sulfur oxidizers_thymidylate kinase Metabolism;Nucleotide metabolism;Pyrimidine metabolism 205 45.934 -130.0138 1450 gi|118602320|ref|YP_903535.1| 0.995 1 2 LVGIVSIGDVHR Gamma sulfur oxidizers_signal-transduction protein Unassigned 205 45.934 -130.0138 1450 gi|148244428|ref|YP_001219122.1| 0.995 1 2 LVGIVSIGDVHR Gamma sulfur oxidizers_signal-transduction protein Unassigned 205 45.934 -130.0138 1450 gi|269469032|gb|EEZ80596.1| 0.995 1 2 LVGIVSIGDVHR Gamma sulfur oxidizers_signal-transduction protein Unassigned 205 45.934 -130.0138 1450 gi|269469202|gb|EEZ80738.1| 0.995 1 2 LVGIVSIGDVHR Gamma sulfur oxidizers_signal-transduction protein Unassigned 206 45.934 -130.0138 1450 gi|118602355|ref|YP_903570.1| 0.995 1 2 MEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 206 45.934 -130.0138 1450 gi|148244459|ref|YP_001219153.1| 0.995 1 2 MEEMGVNDNYIQGWVAGFLNNPEIEEQR Gamma sulfur oxidizers_hypothetical protein Rmag_0321 Unassigned 210 45.934 -130.0138 1450 gi|118602768|ref|YP_903983.1| 0.995 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 210 45.934 -130.0138 1450 gi|148244858|ref|YP_001219552.1| 0.995 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 210 45.934 -130.0138 1450 gi|269468202|gb|EEZ79895.1| 0.995 1 2 ALADFLFDTEQAIVR Gamma sulfur oxidizers_ATPase Unassigned 214 45.934 -130.0138 1450 gi|118602966|ref|YP_904181.1| 0.995 1 2 TGLIMGSGGASNQNVVEAADILR Gamma sulfur oxidizers_3-oxoacyl-acyl-carrier-protein Metabolism;Lipid metabolism;Fatty acid biosynthesis 218 45.934 -130.0138 1450 gi|148244575|ref|YP_001219269.1| 0.995 1 2 APIAGIAMGLVK Gamma sulfur oxidizers_polynucleotide phosphorylase/polyadenylase Metabolism;Nucleotide metabolism 224 45.934 -130.0138 1450 gi|260072671|gb|ACX30568.1| 0.995 1 2 ITEIILNEFGVEK Gamma sulfur oxidizers_dihydroneopterin aldolase Metabolism;Metabolism of cofactors and vitamins;Folate biosynthesis 224 45.934 -130.0138 1450 gi|269468431|gb|EEZ80096.1| 0.995 1 2 ITEIILNEFGVEK Gamma sulfur oxidizers_dihydroneopterin aldolase Metabolism;Metabolism of cofactors and vitamins;Folate biosynthesis 226 45.934 -130.0138 1450 gi|260072679|gb|ACX30576.1| 0.995 1 2 AYLYTSNPDTSTGDGIAMAYR Gamma sulfur oxidizers_aspartate oxidase Metabolism;Amino acid metabolism;Alanine;aspartate and glutamate metabolism 226 45.934 -130.0138 1450 gi|269468438|gb|EEZ80103.1| 0.995 1 2 AYLYTSNPDTSTGDGIAMAYR Gamma sulfur oxidizers_aspartate oxidase Metabolism;Amino acid metabolism;Alanine;aspartate and glutamate metabolism 228 45.934 -130.0138 1450 gi|269467840|gb|EEZ79586.1| 0.995 1 2 VFDGDSPSLLNFK Gamma sulfur oxidizers_2-polyprenyl-6-methoxyphenol hydroxylase Unassigned 229 45.934 -130.0138 1450 gi|269467858|gb|EEZ79601.1| 0.995 1 2 NMSVKEQANEVR Gamma sulfur oxidizers_IMP dehydrogenase/GMP reductase Metabolism;Nucleotide metabolism;Purine metabolism 234 45.934 -130.0138 1450 gi|269468280|gb|EEZ79964.1| 0.995 1 2 YLAQGEVIDLKTR Gamma sulfur oxidizers_protein-disulfide isomerase Unassigned 242 45.934 -130.0138 1450 gi|269469235|gb|EEZ80763.1| 0.995 1 2 IATFEDDEGAYDQK Gamma sulfur oxidizers_argininosuccinate synthase Metabolism;Amino acid metabolism;Alanine;aspartate and glutamate metabolism 244 45.934 -130.0138 1450 gi|344260781|gb|EGW21053.1| 0.995 1 2 LMDFGAFVTILPGK Methylotrophs_Polyribonucleotide nucleotidyltransferase Metabolism;Nucleotide metabolism 244 45.934 -130.0138 1450 gi|357404301|ref|YP_004916225.1| 0.995 1 2 LMDFGAFVTILPGK Methylotrophs_Polyribonucleotide nucleotidyltransferase Metabolism;Nucleotide metabolism 253 45.934 -130.0138 1450 gi|269468984|gb|EEZ80557.1| 0.9941 2 2 LLDALLVMSQK Gamma sulfur oxidizers_sugar phosphate isomerase Unassigned 253 45.934 -130.0138 1450 gi|269468984|gb|EEZ80557.1| 0.9941 2 2 LLDALLVM[147]SQK Gamma sulfur oxidizers_sugar phosphate isomerase Unassigned 257 45.934 -130.0138 1450 gi|302877787|ref|YP_003846351.1| 0.9926 2 2 LLDQGQAGDNVGVLLR Iron oxidizers_translation elongation factor Tu Unassigned 257 45.934 -130.0138 1450 gi|302877787|ref|YP_003846351.1| 0.9926 2 2 QVGVPYIVVFLNK Iron oxidizers_translation elongation factor Tu Unassigned 257 45.934 -130.0138 1450 gi|302877799|ref|YP_003846363.1| 0.9926 2 2 LLDQGQAGDNVGVLLR Iron oxidizers_translation elongation factor Tu Unassigned 257 45.934 -130.0138 1450 gi|302877799|ref|YP_003846363.1| 0.9926 2 2 QVGVPYIVVFLNK Iron oxidizers_translation elongation factor Tu Unassigned 265 45.934 -130.0138 1450 gi|118602392|ref|YP_903607.1| 0.9875 1 2 FIHPNAQINIK Gamma sulfur oxidizers_TrkH family potassium uptake protein Unassigned 265 45.934 -130.0138 1450 gi|148244494|ref|YP_001219188.1| 0.9875 1 2 FIHPNAQINIK Gamma sulfur oxidizers_TrkH family potassium uptake protein Unassigned 266 45.934 -130.0138 1450 gi|302877279|ref|YP_003845843.1| 0.9857 2 2 WYGM[147]KATTPIISGGMNALR Iron oxidizers_ribulose-bisphosphate carboxylase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 266 45.934 -130.0138 1450 gi|302877279|ref|YP_003845843.1| 0.9857 2 2 ATTPIISGGMNALR Iron oxidizers_ribulose-bisphosphate carboxylase Metabolism;Energy Metabolism;Carbon fixation in photosynthetic organisms 270 45.934 -130.0138 1450 gi|118602761|ref|YP_903976.1| 0.9777 1 2 APVFISQLWYK Gamma sulfur oxidizers_peptidase M16 domain-containing protein Unassigned 271 45.934 -130.0138 1450 gi|148244615|ref|YP_001219309.1| 0.9743 1 2 TLSGQMTEAFYNSLR Gamma sulfur oxidizers_5-methyltetrahydrofolate--homocysteine methyltransferase Metabolism;Amino acid metabolism;Cysteine and methionine metabolism 276 45.934 -130.0138 1450 gi|269467789|gb|EEZ79547.1| 0.9666 2 2 ANASVIEILENANTLVK Gamma sulfur oxidizers_isoleucyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 276 45.934 -130.0138 1450 gi|269467789|gb|EEZ79547.1| 0.9666 2 2 WQDDNLYAR Gamma sulfur oxidizers_isoleucyl-tRNA synthetase Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 278 45.934 -130.0138 1450 gi|291612487|ref|YP_003522644.1| 0.9628 1 2 GLMTTVHAATATQK Bacteria_glyceraldehyde-3-phosphate dehydrogenase;type I Metabolism;Carbohydrate metabolism;Glycolysis/Gluconeogenesis 278 45.934 -130.0138 1450 gi|302877274|ref|YP_003845838.1| 0.9628 1 2 GLMTTVHAATATQK Bacteria_glyceraldehyde-3-phosphate dehydrogenase;type I Metabolism;Carbohydrate metabolism;Glycolysis/Gluconeogenesis 278 45.934 -130.0138 1450 gi|356960186|ref|ZP_09063168.1| 0.9628 1 2 GLMTTVHAATATQK Bacteria_glyceraldehyde-3-phosphate dehydrogenase;type I Metabolism;Carbohydrate metabolism;Glycolysis/Gluconeogenesis 279 45.934 -130.0138 1450 gi|269468607|gb|EEZ80251.1| 0.9618 1 2 VTGFLEGEDALSTLK Gamma sulfur oxidizers_5-enolpyruvylshikimate-3-phosphate synthase Metabolism;Amino acid metabolism;Phenylalanine;tyrosine and tryptophan biosynthesis 284 45.934 -130.0138 1450 gi|344263301|gb|EGW23572.1| 0.959 1 2 VLSWYDNEWGFSNR Methylotrophs_glyceraldehyde-3-phosphate dehydrogenase;type I Metabolism;Carbohydrate metabolism;Glycolysis/Gluconeogenesis 285 45.934 -130.0138 1450 gi|118602282|ref|YP_903497.1| 0.9584 2 2 GWLQPIADALK Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 285 45.934 -130.0138 1450 gi|118602282|ref|YP_903497.1| 0.9584 2 2 YPLLGALR Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 285 45.934 -130.0138 1450 gi|148244396|ref|YP_001219090.1| 0.9584 2 2 GWLQPIADALK Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 285 45.934 -130.0138 1450 gi|148244396|ref|YP_001219090.1| 0.9584 2 2 YPLLGALR Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 285 45.934 -130.0138 1450 gi|269469175|gb|EEZ80717.1| 0.9584 2 2 GWLQPIADALK Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 285 45.934 -130.0138 1450 gi|269469175|gb|EEZ80717.1| 0.9584 2 2 YPLLGALR Gamma sulfur oxidizers_respiratory-chain NADH dehydrogenase;subunit 1 Metabolism;Energy Metabolism;Oxidative phosphorylation or nitrogen metabolism 288 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9532 4 2 YPQPQHIIEYTHDLIQR Gamma sulfur oxidizers_hypothetical protein Rmag_0863 Unassigned (dsrK homolog) 288 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9532 4 2 EFDIPVLPTYLEIPELK Gamma sulfur oxidizers_hypothetical protein Rmag_0863 Unassigned (dsrK homolog) 288 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9532 4 2 AALDLEVSR Gamma sulfur oxidizers_hypothetical protein Rmag_0863 Unassigned (dsrK homolog) 288 45.934 -130.0138 1450 gi|118602835|ref|YP_904050.1| 0.9532 4 2 AVCNNYVDMER Gamma sulfur oxidizers_hypothetical protein Rmag_0863 Unassigned (dsrK homolog) 289 45.934 -130.0138 1450 gi|148244667|ref|YP_001219361.1| 0.9529 1 2 LSDCISTDLNQTEVFLVEGDSAGGSAK Gamma sulfur oxidizers_DNA topoisomerase IV subunit B Unassigned 290 45.934 -130.0138 1450 gi|356960509|ref|ZP_09063491.1| 0.9524 1 2 FTALQSGEIDMLSR Gamma sulfur oxidizers_amino acid ABC transporter periplasmic protein Environmental Information Processing;Membrane transport;ABC transporters 291 45.934 -130.0138 1450 gi|269468572|gb|EEZ80221.1| 0.9514 1 2 HVALLSTLKPGEVR Gamma sulfur oxidizers_F0F1-type ATP synthase;epsilon subunit Metabolism;Energy metabolism;Oxidative phosphorylation 297 45.934 -130.0138 1450 gi|269468541|gb|EEZ80195.1| 0.9431 1 2 YNFEIADTEVLFR Gamma sulfur oxidizers_glycyl-tRNA synthetase;alpha subunit Genetic Information Processing;Translation;Aminoacyl-tRNA biosynthesis 302 45.934 -130.0138 1450 gi|269468850|gb|EEZ80451.1| 0.932 2 2 LPAYVFAVTNELK Gamma sulfur oxidizers_aminotransferase Unassigned (probably should be Metabolism;amino acid biosynthesis) 302 45.934 -130.0138 1450 gi|269468850|gb|EEZ80451.1| 0.932 2 2 VGFMVGNPVLVSALAK Gamma sulfur oxidizers_aminotransferase Unassigned (probably should be Metabolism;amino acid biosynthesis) 303 45.934 -130.0138 1450 gi|269468596|gb|EEZ80240.1| 0.9277 1 2 GFDVVSGGTDDHLFLVSFIDQGLTGK Gamma sulfur oxidizers_glycine/serine hydroxymethyltransferase Metabolism;Carbohydrate metabolism;Glyoxylate and dicarboxylate metabolism 304 45.934 -130.0138 1450 gi|269468246|gb|EEZ79936.1| 0.9272 1 2 EINPEPM[147]VEILEK Gamma sulfur oxidizers_hypothetical protein Sup05_1091 Unassigned 305 45.934 -130.0138 1450 gi|260072650|gb|ACX30548.1| 0.925 2 2 LSTEEFDSVK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC49P140031 Unassigned 305 45.934 -130.0138 1450 gi|260072650|gb|ACX30548.1| 0.925 2 2 GETSVSFAGGESGTLNGK Gamma sulfur oxidizers_hypothetical protein SUP05_FGYC49P140031 Unassigned 310 45.934 -130.0138 1450 gi|148245097|ref|YP_001219791.1| 0.9166 1 2 QEFLSEMGQSESGLDR Gamma sulfur oxidizers_GTP-dependent nucleic acid-binding protein EngD Unassigned 312 45.934 -130.0138 1450 gi|269469076|gb|EEZ80631.1| 0.9139 1 2 KEENFAEEVAAQMK Gamma sulfur oxidizers_translation elongation factor Ts Unassigned 313 45.934 -130.0138 1450 gi|118602924|ref|YP_904139.1| 0.9104 1 2 FNPIYYMVDSFR Gamma sulfur oxidizers_ABC-2 type transporter Environmental Information Processing;Membrane transport;ABC transporters 313 45.934 -130.0138 1450 gi|148244996|ref|YP_001219690.1| 0.9104 1 2 FNPIYYMVDSFR Gamma sulfur oxidizers_ABC-2 type transporter Environmental Information Processing;Membrane transport;ABC transporters 313 45.934 -130.0138 1450 gi|260072673|gb|ACX30570.1| 0.9104 1 2 FNPIYYMVDSFR Gamma sulfur oxidizers_ABC-2 type transporter Environmental Information Processing;Membrane transport;ABC transporters 313 45.934 -130.0138 1450 gi|269468433|gb|EEZ80098.1| 0.9104 1 2 FNPIYYMVDSFR Gamma sulfur oxidizers_ABC-2 type transporter Environmental Information Processing;Membrane transport;ABC transporters 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 FLSQPFFVAEVFTGSPGK Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 NIAIEHSGYSVFAGVGER Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 YTLAGTEVSALLGR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 VALTGLTM[147]AEYFR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 VSLVYGQMNEPPGNR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 DIIAILGMDELSEEDK Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 DIIAILGM[147]DELSEEDK Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 TVNMMELIR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 DVLFFVDNIYR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 VSLVYGQM[147]NEPPGNR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 VGLFGGAGVGK Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 106c 45.934 -130.0138 1450 gi|344263035|gb|EGW23306.1| 0.9911 12 2 VALTGLTMAEYFR Methylotrophs_ATP synthase subunit beta Metabolism;Energy metabolism;Oxidative phosphorylation 114b 45.934 -130.0138 1450 gi|118602210|ref|YP_903425.1| 0.9529 5 2 IEPQEPGAGYEFVDEIK Gamma sulfur oxidizers_translation elongation factor 2 (EF-2/EF-G) Unassigned 114b 45.934 -130.0138 1450 gi|118602210|ref|YP_903425.1| 0.9529 5 2 MEFPEPVIALAVEPK Gamma sulfur oxidizers_translation elongation factor 2 (EF-2/EF-G) Unassigned 114b 45.934 -130.0138 1450 gi|118602210|ref|YP_903425.1| 0.9529 5 2 INIIDTPGHVDFTIEVER Gamma sulfur oxidizers_translation elongation factor 2 (EF-2/EF-G) Unassigned 114b 45.934 -130.0138 1450 gi|118602210|ref|YP_903425.1| 0.9529 5 2 NVGDDEPFAALAFK Gamma sulfur oxidizers_translation elongation factor 2 (EF-2/EF-G) Unassigned 114b 45.934 -130.0138 1450 gi|118602210|ref|YP_903425.1| 0.9529 5 2 AGDIAAAIGLK Gamma sulfur oxidizers_translation elongation factor 2 (EF-2/EF-G) Unassigned 117c 45.934 -130.0138 1450 gi|356960708|ref|ZP_09063690.1| 0.9637 4 2 NGVHIINLEK Gamma sulfur oxidizers_30S ribosomal protein S2;partial Genetic Information Processing;Translation;Ribosome 117c 45.934 -130.0138 1450 gi|356960708|ref|ZP_09063690.1| 0.9637 4 2 WLGGMMTNYK Gamma sulfur oxidizers_30S ribosomal protein S2;partial Genetic Information Processing;Translation;Ribosome 117c 45.934 -130.0138 1450 gi|356960708|ref|ZP_09063690.1| 0.9637 4 2 EIANAVLEAK Gamma sulfur oxidizers_30S ribosomal protein S2;partial Genetic Information Processing;Translation;Ribosome 117c 45.934 -130.0138 1450 gi|356960708|ref|ZP_09063690.1| 0.9637 4 2 MLEAGVHFGHR Gamma sulfur oxidizers_30S ribosomal protein S2;partial Genetic Information Processing;Translation;Ribosome 186a 45.934 -130.0138 1450 gi|269468551|gb|EEZ80200.1| 0.9954 2 2 LALEELGPIFIK Gamma sulfur oxidizers_hypothetical protein Sup05_0669 Metabolism;Metabolism of Cofactors and Vitamins;Ubiquinone and other terpenoid-quinone biosynthesis 186a 45.934 -130.0138 1450 gi|269468551|gb|EEZ80200.1| 0.9954 2 2 LAEEGVIIFFTQVFK Gamma sulfur oxidizers_hypothetical protein Sup05_0669 Metabolism;Metabolism of Cofactors and Vitamins;Ubiquinone and other terpenoid-quinone biosynthesis 196a 45.934 -130.0138 1450 gi|269468797|gb|EEZ80401.1| 0.9959 2 2 VSLASDPVDEVK Gamma sulfur oxidizers_4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 196a 45.934 -130.0138 1450 gi|269468797|gb|EEZ80401.1| 0.9959 2 2 IGVNAGSLEK Gamma sulfur oxidizers_4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase Metabolism;Metabolism of Terpenoids and Polyketides;Terpenoid backbone biosynthesis 197a 45.934 -130.0138 1450 gi|71083583|ref|YP_266302.1| 0.9946 2 2 VYDQMPEPR SAR11_nuoB gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 197a 45.934 -130.0138 1450 gi|71083583|ref|YP_266302.1| 0.9946 2 2 QSDVM[147]IVAGTLTNK SAR11_nuoB gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 197a 45.934 -130.0138 1450 gi|91717798|gb|EAS84448.1| 0.9946 2 2 VYDQMPEPR SAR11_nuoB gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 197a 45.934 -130.0138 1450 gi|91717798|gb|EAS84448.1| 0.9946 2 2 QSDVM[147]IVAGTLTNK SAR11_nuoB gene product Metabolism;Energy Metabolism;Oxidative phosphorylation 295a 45.934 -130.0138 1450 gi|118602592|ref|YP_903807.1| 0.9433 2 2 ISVVIDEK Gamma sulfur oxidizers_aspartate kinase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Cysteine and methionine metabolism or lysine biosynthesis 295a 45.934 -130.0138 1450 gi|118602592|ref|YP_903807.1| 0.9433 2 2 EGLTNFAFTVHR Gamma sulfur oxidizers_aspartate kinase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Cysteine and methionine metabolism or lysine biosynthesis 295a 45.934 -130.0138 1450 gi|148244688|ref|YP_001219382.1| 0.9433 2 2 ISVVIDEK Gamma sulfur oxidizers_aspartate kinase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Cysteine and methionine metabolism or lysine biosynthesis 295a 45.934 -130.0138 1450 gi|148244688|ref|YP_001219382.1| 0.9433 2 2 EGLTNFAFTVHR Gamma sulfur oxidizers_aspartate kinase Metabolism;Amino Acid Metabolism;Glycine;serine and threonine metabolism or Cysteine and methionine metabolism or lysine biosynthesis 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 AFESFPGDADSLYPGWR Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 NIAYMIER Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 LMGASGIHVGTMGYGK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 KNGGYIAGTIIKPK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 QMLDIFDGPSVDITDLWNLLGR Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 LMGASGIHVGTM[147]GYGK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79b 45.934 -130.0138 1450 gi|148244796|ref|YP_001219490.1| 0.9735 7 2 DSADGPVYHQEWFGMKPTTPIISGGMNALR Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 DLDAMVYEIDEAK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 DLDAM[147]VYEIDEAK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 LPGFFENLGHGNVINTSGGGSYGHIDSPAAGAK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 NIAYMIER Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 LMGASGIHVGTMGYGK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 GYTAFVLGK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 LMGASGIHVGTM[147]GYGK Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 79c 45.934 -130.0138 1450 gi|118602694|ref|YP_903909.1| 0.9583 8 2 DSADGPVYHQEWFGMKPTTPIISGGMNALR Gamma sulfur oxidizers_ribulose bisphosphate carboxylase Metabolism;Energy metabolism;Carbon fixation in photosynthetic organisms 207 45.934 -130.0138 1450 gi|118602474|ref|YP_903689.1| 0.995 1 1 GETQALVVTTLGSK Gamma sulfur oxidizers_polynucleotide phosphorylase/polyadenylase Metabolism;Nucleotide metabolism 207 45.934 -130.0138 1450 gi|269467861|gb|EEZ79604.1| 0.995 1 1 GETQALVVTTLGSK Gamma sulfur oxidizers_polynucleotide phosphorylase/polyadenylase Metabolism;Nucleotide metabolism 237 45.934 -130.0138 1450 gi|269468713|gb|EEZ80338.1| 0.995 1 1 LALGDHAYNIVMSSTK Gamma sulfur oxidizers_3-oxoacyl-(acyl-carrier-protein) synthase Metabolism;Lipid metabolism;Fatty acid biosynthesis 243 45.934 -130.0138 1450 gi|344260434|gb|EGW20706.1| 0.995 1 1 TGGNVLLLDEPTNDLDVETLR Methylotrophs_ATP-binding cassette protein;ChvD family Unassigned 247 45.934 -130.0138 1450 gi|71083646|ref|YP_266366.1| 0.995 1 1 ADEVVAAYDSGR SAR11_yhdW gene product Environmental Information Processing;Membrane transport;ABC transporters 247 45.934 -130.0138 1450 gi|91717727|gb|EAS84378.1| 0.995 1 1 ADEVVAAYDSGR SAR11_yhdW gene product Environmental Information Processing;Membrane transport;ABC transporters 258 45.934 -130.0138 1450 gi|118602968|ref|YP_904183.1| 0.9913 2 1 AGSLSAPIEIIEER Gamma sulfur oxidizers_protein-export membrane protein SecD Genetic Information Processing;Folding;sorting and degradation;Protein export 258 45.934 -130.0138 1450 gi|118602968|ref|YP_904183.1| 0.9913 2 1 DIINAATIQSAFSSR Gamma sulfur oxidizers_protein-export membrane protein SecD Genetic Information Processing;Folding;sorting and degradation;Protein export 268 45.934 -130.0138 1450 gi|148244680|ref|YP_001219374.1| 0.9811 1 1 ALGLNDELAHSSIR Gamma sulfur oxidizers_cysteine desulfurase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 268 45.934 -130.0138 1450 gi|269468721|gb|EEZ80343.1| 0.9811 1 1 ALGLNDELAHSSIR Gamma sulfur oxidizers_cysteine desulfurase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 287 45.934 -130.0138 1450 gi|357407312|ref|YP_004919236.1| 0.9538 1 1 NHGVTAPIDVHLMIDPVDR Methylotrophs_ppe gene product Metabolism;Carbohydrate metabolism;Pentose phosphate pathway 293 45.934 -130.0138 1450 gi|148244349|ref|YP_001219043.1| 0.9491 1 1 HSADYIDSVMSR Gamma sulfur oxidizers_preprotein translocase SecY subunit Genetic Information Processing;Folding;sorting and degradation;Protein export 296 45.934 -130.0138 1450 gi|148244960|ref|YP_001219654.1| 0.9445 1 1 FGGQVVLAGNILVR Gamma sulfur oxidizers_50S ribosomal protein L27 Genetic Information Processing;Translation;Ribosome 296 45.934 -130.0138 1450 gi|269468381|gb|EEZ80046.1| 0.9445 1 1 FGGQVVLAGNILVR Gamma sulfur oxidizers_50S ribosomal protein L27 Genetic Information Processing;Translation;Ribosome 306 45.934 -130.0138 1450 gi|118602286|gb|EEZ79649.1| 0.9245 1 1 YSSQVVDGYER Gamma sulfur oxidizers_dihydroxyacid dehydratase/phosphogluconate dehydratase Metabolism;Amino acid metabolism;Valine;leucine and isoleucine biosynthesis 311 45.934 -130.0138 1450 gi|269467938|gb|EEZ79673.1| 0.9166 1 1 LFIELLQQK Gamma sulfur oxidizers_UTP:GlnB uridylyltransferase Environmental Information Processing;Signal transduction;Two-component system 317 45.934 -130.0138 1450 gi|344261056|gb|EGW21327.1| 0.9052 1 1 MLDMGFLPDIK Methylotrophs_DEAD/DEAH box helicase domain protein Genetic Information Processing;Folding;sorting and degradation;RNA degradation 123b 45.934 -130.0138 1450 gi|148244296|ref|YP_001218990.1| 0.9942 2 1 GEAISLVSADEAK Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;sorting and degradation;RNA degradation 123b 45.934 -130.0138 1450 gi|148244296|ref|YP_001218990.1| 0.9942 2 1 VNVLVATDIAAR Gamma sulfur oxidizers_ATP-dependent RNA helicase RhlE Genetic Information Processing;Folding;sorting and degradation;RNA degradation 70a 45.934 -130.0138 1450 gi|148244531|ref|YP_001219225.1| 0.9991 2 1 WGADTIMDLSTGK Gamma sulfur oxidizers_thiamine biosynthesis protein ThiC Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 70a 45.934 -130.0138 1450 gi|148244531|ref|YP_001219225.1| 0.9991 2 1 NSPVPIGTVPIYQALEK Gamma sulfur oxidizers_thiamine biosynthesis protein ThiC Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 70b 45.934 -130.0138 1450 gi|344263357|gb|EGW23628.1| 0.9991 2 1 INGNLGNSAVTSSIEEEVEK Methylotrophs_Phosphomethylpyrimidine synthase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 70b 45.934 -130.0138 1450 gi|344263357|gb|EGW23628.1| 0.9991 2 1 NSPVPIGTVPIYQALEK Methylotrophs_Phosphomethylpyrimidine synthase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 70b 45.934 -130.0138 1450 gi|357404025|ref|YP_004915949.1| 0.9991 2 1 INGNLGNSAVTSSIEEEVEK Methylotrophs_Phosphomethylpyrimidine synthase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 70b 45.934 -130.0138 1450 gi|357404025|ref|YP_004915949.1| 0.9991 2 1 NSPVPIGTVPIYQALEK Methylotrophs_Phosphomethylpyrimidine synthase Metabolism;Metabolism of cofactors and vitamins;Thiamine metabolism 83b 45.934 -130.0138 1450 gi|118602541|ref|YP_903756.1| 0.9483 3 1 AAIGTTGNGIGPAYEDK Gamma sulfur oxidizers_adenylosuccinate synthetase Metabolism;Nucleotide metabolism;Purine metabolism 83b 45.934 -130.0138 1450 gi|118602541|ref|YP_903756.1| 0.9483 3 1 NVVIIGTQWGDEGK Gamma sulfur oxidizers_adenylosuccinate synthetase Metabolism;Nucleotide metabolism;Purine metabolism 83b 45.934 -130.0138 1450 gi|118602541|ref|YP_903756.1| 0.9483 3 1 VLGTVGHEFGATTGR Gamma sulfur oxidizers_adenylosuccinate synthetase Metabolism;Nucleotide metabolism;Purine metabolism